DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NPM1 and Nph

DIOPT Version :10

Sequence 1:NP_002511.1 Gene:NPM1 / 4869 HGNCID:7910 Length:294 Species:Homo sapiens
Sequence 2:NP_651760.1 Gene:Nph / 43559 FlyBaseID:FBgn0039735 Length:156 Species:Drosophila melanogaster


Alignment Length:188 Identity:46/188 - (24%)
Similarity:75/188 - (39%) Gaps:75/188 - (39%)


- Green bases have known domain annotations that are detailed below.


Human    38 NEHQLSLRTVSLGAGAK-DELHIVEAEA-MNYEG--SPIKVTLATLKM----SVQPTVSLGGFEI 94
            :.|:|.::.:|||..|| .|.::|:||. :|.:|  ..:|:.:|.||:    |::|.|......:
  Fly    32 HSHKLIIKQISLGPEAKTGEFNVVQAETNINDDGEKKTLKIPIAVLKVGETRSLRPNVEFPNGSV 96

Human    95 TPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEEEEDVKLLSISGKRSAPGGGSKVPQKKVKLA 159
            |    .:|..||||||:.|                                         ||::.
  Fly    97 T----FKLVQGSGPVHVCG-----------------------------------------KVEMN 116

Human   160 ADEDDDDD--DEEDDDEDDDDDDFDDEEAEEKAPVKKSIRDTPAKNAQKSNQNGKDSK 215
            ..|.||..  :|..|:|:|.:.:||:|.|.:                    .|||.:|
  Fly   117 FGEFDDGQIYEEYSDEEEDSELEFDEEAAPQ--------------------TNGKSNK 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NPM1NP_002511.1 Required for interaction with SENP3 1..186 41/157 (26%)
Necessary for interaction with APEX1. /evidence=ECO:0000269|PubMed:19188445 1..117 29/86 (34%)
Nucleoplasmin 18..117 CDD:460792 29/86 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 120..247 17/98 (17%)
Nuclear localization signal. /evidence=ECO:0000255 152..157 1/4 (25%)
Interaction with NOP2. /evidence=ECO:0000269|PubMed:8089149 187..215 3/27 (11%)
Nuclear localization signal. /evidence=ECO:0000255 191..197 0/5 (0%)
Required for nucleolar localization 243..294
NPM1-C 245..293 CDD:465081
NphNP_651760.1 Nucleoplasmin 6..112 CDD:460792 29/124 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.