DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NPHS1 and side-VIII

DIOPT Version :9

Sequence 1:NP_004637.1 Gene:NPHS1 / 4868 HGNCID:7908 Length:1241 Species:Homo sapiens
Sequence 2:NP_001097382.2 Gene:side-VIII / 37310 FlyBaseID:FBgn0086604 Length:1201 Species:Drosophila melanogaster


Alignment Length:985 Identity:206/985 - (20%)
Similarity:316/985 - (32%) Gaps:348/985 - (35%)


- Green bases have known domain annotations that are detailed below.


Human   208 SSDNRQLLVCEASSPALEAPIKASFTVNV-----------------LFPPGPPVIEWPGLDEGHV 255
            ||.:..|.:|.....||..|..|:..|.|                 |...||||     |.|..:
  Fly     5 SSRSLFLPLCLLVLSALNGPAAAASRVRVSSSTTMTRNIEEENALLLLLAGPPV-----LSESIM 64

Human   256 RAGQSLELPCVARGGNP------LATLQWLKNG--QPV------------STAWGTE-------- 292
              |....|||   ...|      :|.:.|.|.|  .|:            .|.|..|        
  Fly    65 --GTVGRLPC---NVTPPIYEDRVALVIWYKVGLKTPIYSVDTRDSNFAQGTHWSDETYRERLSF 124

Human   293 HTQAVARSVLVMTVRPEDHGAQLSCEAHNSVSAGTQEHGITLQVTFPPSAIIILGSASQT----- 352
            |.:..|.::.:.:...:|.| :..|......|. |:...:.|.|..||.::|||.|...|     
  Fly   125 HVEGRAGTLTIKSTTEDDTG-EYRCRVDFQKSP-TRNSKVNLTVIIPPESVIILDSKGVTIEDHT 187

Human   353 -----ENKNVTLSCVSKSSRPRVLLRWWLGWRQLLPMEETVMDGLHGGHI-------------SM 399
                 |...:.::||:...||:..:.|                 |||..:             .:
  Fly   188 LGPYNEGSGINITCVAIGGRPQPRVTW-----------------LHGNTVYKNASVGQPLSERRV 235

Human   400 SNLTFLARREDNGL--TLTCEAFSEAFTKETFKKSLILNVKYPAQKLWIEGPPEGQKLRAGTRVR 462
            .|...|||.|...|  .|||.|.:...|.... .|::|::......:.::|  |.:.|.||...:
  Fly   236 GNTLSLARLERRNLHMQLTCRAENNNLTTPII-SSVVLDMNLRPLIVKLQG--ENRALSAGNSYQ 297

Human   463 LVCLAIGGNPEPSLMWYKDSRTVTESRLPQESRRVHLGSVEKSGSTFSRELVLVTGPSDNQAKFT 527
            |.|:.||..|.|::.|:|                         |||          |..|..:..
  Fly   298 LSCVVIGARPAPTITWWK-------------------------GST----------PMKNTHEIA 327

Human   528 CKAGQLSASTQLAVQFPPTNVTILANASALRPGDALNLTCVSVSSNPPVNLSWDKEGERLEGVAA 592
            ...|.|:.|   .:.|.||                                              
  Fly   328 TPDGNLTTS---VLTFTPT---------------------------------------------- 343

Human   593 PPRRAPFKGSAAARSVLLQVSSRDHGQRVTCRAHSAELRET-VSSFYRLNVLYRPEF---LGEQV 653
                                 ..|.|:.::|||..:.:.|: :...::|::.:.|..   ||...
  Fly   344 ---------------------IDDRGKFLSCRAEQSMIPESGMEDGWKLDIYHIPVVSLELGTNS 387

Human   654 LVVTAVEQGEALLPVSVSANPAPEAFNWTFRGYRL--SPAGGPRHRILSSGALHLWNVTRADDGL 716
            |..|..|..:.....::.:||.....:|...|..|  :||.|   ..:|:.:|.|.|.:||..|:
  Fly   388 LNSTLREGIDVFFECNIKSNPWIYEVSWRHNGKILTNNPAEG---IAVSNQSLVLQNASRARSGI 449

Human   717 YQLHCQNSEGTAEAR-LRLDVHYAPTIRALQDPTEVNVG--GSVDIVCTVDANPILPGMFNWERL 778
            |.....|.||..|:. ::||:.:||..|..| ....:.|  .:|.:.|.:|||| ....:.|:  
  Fly   450 YTCVGSNREGDGESNPVQLDIRFAPVCRPRQ-RLSYSSGRHETVKVACEIDANP-AEATYVWK-- 510

Human   779 GEDEEDQSLDDMEKISRGPTGRLRIHHAKLAQAGAYQCIVDNGVAPPARRLLRLVVRFAPQVEHP 843
                        ...::|.|          ....|.|..||.|                ..:.|.
  Fly   511 ------------FNATQGET----------VDIPASQVAVDRG----------------RSIAHY 537

Human   844 TPLTKVAAAGDSTSSATLHCRARGVPNIVFTWTKNGVPLDLQDPRYTEHTYHQGGVHSSLLTIAN 908
            ||:|:                                                            
  Fly   538 TPMTE------------------------------------------------------------ 542

Human   909 VSAAQDYALFTCTATNALGSDQTNIQLVSI---SRPDPPSGLKVVSLTPHSVGLEWKPGFDGGLP 970
                .||....|.|||.:| ||:...:.:|   ..|||.....|::.|.....:|...||:|||.
  Fly   543 ----NDYGTLLCWATNEIG-DQSEPCVYTIFPAGEPDPLLNCTVLNQTSTGFQIECIEGFNGGLQ 602

Human   971 QRFCIRYEALGTPGFHYVDVVPPQATTFTLTGLQPSTRYRVWLLASNALGDSGLADKGTQLPITT 1035
            |.|.:.....||.  .:..:...:...|.::||.|...|.|:|:|:|:.|.|    ..|.|.:.|
  Fly   603 QDFIMEVYMNGTT--RHPKISKSKRPYFEVSGLVPGMGYNVFLIANNSKGRS----NATILQVYT 661

Human  1036 PGLHQPSGEPEDQLPTEPPSGPSGLPLLPVLFALGGLLLLSNASCVGGVLWQRRLRRLAEGIS-- 1098
              |..|..:......|:...|     |.|. :........:.:.||..   :.....|.:|||  
  Fly   662 --LKDPEKQTVKITFTKSFQG-----LRPA-YTKTKATATTTSDCVCD---EDEFLNLGKGISHD 715

Human  1099 EKTEAGSEED 1108
            |.|:|..:||
  Fly   716 EGTDADQQED 725

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NPHS1NP_004637.1 V-set 38..119 CDD:284989
IG_like 38..113 CDD:214653
C2-set_2 141..228 CDD:285423 6/19 (32%)
Ig 240..321 CDD:299845 24/108 (22%)
IG_like 254..336 CDD:214653 21/109 (19%)
Ig 345..424 CDD:299845 23/103 (22%)
Ig 445..530 CDD:299845 18/84 (21%)
I-set 446..541 CDD:254352 21/94 (22%)
Ig 549..632 CDD:299845 5/82 (6%)
IG_like 558..642 CDD:214653 7/84 (8%)
I-set 646..736 CDD:254352 27/95 (28%)
Ig 662..736 CDD:299845 21/76 (28%)
Ig_3 739..820 CDD:290638 17/82 (21%)
IG_like 748..821 CDD:214653 14/74 (19%)
Ig8_hNephrin_like 834..942 CDD:143250 14/110 (13%)
IG_like 845..935 CDD:214653 11/89 (12%)
fn3 942..1023 CDD:278470 24/80 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1025..1057 6/31 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1099..1137 5/10 (50%)
Binds to NPHS2 1160..1241
side-VIIINP_001097382.2 Ig 55..166 CDD:299845 27/122 (22%)
IG_like 60..166 CDD:214653 22/112 (20%)
Ig 182..266 CDD:299845 21/100 (21%)
Ig 296..373 CDD:299845 26/181 (14%)
IG_like 389..464 CDD:214653 22/77 (29%)
IGc2 394..459 CDD:197706 18/67 (27%)
Ig_3 490..554 CDD:290638 22/168 (13%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3515
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.