DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment NPHS1 and CG30350

DIOPT Version :9

Sequence 1:	NP_004637.1	Gene:	NPHS1 / 4868	HGNCID:	7908	Length:	1241	Species:	Homo sapiens
Sequence 2:	NP_724715.1	Gene:	CG30350 / 246556	FlyBaseID:	FBgn0050350	Length:	369	Species:	Drosophila melanogaster

Alignment Length:	143	Identity:	33/143 - (23%)
Similarity:	53/143 - (37%)	Gaps:	43/143 - (30%)

- Green bases have known domain annotations that are detailed below.

Human   895 HQGGVHSSLLTIANVSAAQDYALFTCTATNALGSD--------QTNIQ-LVSISRPDPPSGLKVV 950
            |:..:..::.|:.  :.|.::.....|..|.|..:        :.||| ||.|||.....|
  Fly    60 HRERIKGAISTVD--AEAPNFQAARITGVNNLRDEAQTFMKRTKANIQLLVEISRTMRTHG---- 118

Human   951 SLTPHSVGLEWKPGFDGGLPQRFCIRYEALGTPGFHYVDVVPPQATTFTLTGLQPSTR-YRVWLL 1014
            ::.|                    .||:.:     |.|..:|  ....||..|:...| :...:|
  Fly   119 AINP--------------------FRYDTV-----HAVSSIP--MALLTLEKLERDNRDFGRRIL 156

Human  1015 ASNALGDSGLADK 1027
            ..|:..||||:||
  Fly   157 EVNSEVDSGLSDK 169

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
NPHS1	NP_004637.1	V-set	38..119	CDD:284989
		IG_like	38..113	CDD:214653
		C2-set_2	141..228	CDD:285423
		Ig	240..321	CDD:299845
		IG_like	254..336	CDD:214653
		Ig	345..424	CDD:299845
		Ig	445..530	CDD:299845
		I-set	446..541	CDD:254352
		Ig	549..632	CDD:299845
		IG_like	558..642	CDD:214653
		I-set	646..736	CDD:254352
		Ig	662..736	CDD:299845
		Ig_3	739..820	CDD:290638
		IG_like	748..821	CDD:214653
		Ig8_hNephrin_like	834..942	CDD:143250	14/55 (25%)
		IG_like	845..935	CDD:214653	9/48 (19%)
		fn3	942..1023	CDD:278470	14/81 (17%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1025..1057		2/3 (67%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1099..1137
		Binds to NPHS2	1160..1241
CG30350	NP_724715.1	KIAA1430	60..155	CDD:290590	25/127 (20%)
CG30350	NP_724715.1	cyclophilin	212..369	CDD:294131
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG3515
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900