DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Act87E and ACTL6A

DIOPT Version :9

Sequence 1:NP_001287314.1 Gene:Act87E / 48632 FlyBaseID:FBgn0000046 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_004292.1 Gene:ACTL6A / 86 HGNCID:24124 Length:429 Species:Homo sapiens


Alignment Length:423 Identity:156/423 - (36%)
Similarity:230/423 - (54%) Gaps:54/423 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGR--PRHQG--VMVGMGQKDS------YVGDE 58
            |||.|||.|.||...:||:||:|.|:..||:.:|.  .|..|  :|...|.|..      |:...
Human     9 DEVGALVFDIGSYTVRAGYAGEDCPKVDFPTAIGMVVERDDGSTLMEIDGDKGKQGGPTYYIDTN 73

  Fly    59 A-QSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 122
            | :..|..:....|:::|::.:||..:.|..||:...::.....||||::|||.|.:|.|||:|:
Human    74 ALRVPRENMEAISPLKNGMVEDWDSFQAILDHTYKMHVKSEASLHPVLMSEAPWNTRAKREKLTE 138

  Fly   123 IMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHT--VPIYEGYALPHAILRLDLAGRD 185
            :|||.:|.||.::...|||:.:|:||:||::|||  |.:||  :|:::||.|...|::..|||..
Human   139 LMFEHYNIPAFFLCKTAVLTAFANGRSTGLILDS--GATHTTAIPVHDGYVLQQGIVKSPLAGDF 201

  Fly   186 LTDYLMKILTERGYSFT---TTAEREIVRD-------IKEKL-------------CYVALDFEQE 227
            :|....::..|......   ..|.:|.||:       .||||             | |..||:..
Human   202 ITMQCRELFQEMNIELVPPYMIASKEAVREGSPANWKRKEKLPQVTRSWHNYMCNC-VIQDFQAS 265

  Fly   228 MATAAASTSLEK--------SYELPDGQVITIGNERFRCPESLFQPS----FLGMESCGIHETVY 280
            :...:.||..|:        .||.|:|.....|.||.:.||.||.||    ..|....|:...|.
Human   266 VLQVSDSTYDEQVAAQMPTVHYEFPNGYNCDFGAERLKIPEGLFDPSNVKGLSGNTMLGVSHVVT 330

  Fly   281 NSIMKCDVDIRKDLYANIVMSGGTTMYPGIADRMQKEITALAPSTIKIKIIA---PPERKYSVWI 342
            .|:..||:|||..||.:::::||.|:.....||:.:|::...|.::::|:||   ..||::|.||
Human   331 TSVGMCDIDIRPGLYGSVIVAGGNTLIQSFTDRLNRELSQKTPPSMRLKLIANNTTVERRFSSWI 395

  Fly   343 GGSILASLSTFQQMWISKQEYDESGPGIVHRKC 375
            ||||||||.||||||||||||:|.|...|.|||
Human   396 GGSILASLGTFQQMWISKQEYEEGGKQCVERKC 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Act87ENP_001287314.1 PTZ00281 1..376 CDD:173506 156/423 (37%)
ACTL6ANP_004292.1 Actin 11..429 CDD:394979 154/421 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D649708at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.