DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Act87E and actrt2

DIOPT Version :9

Sequence 1:NP_001287314.1 Gene:Act87E / 48632 FlyBaseID:FBgn0000046 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001006111.1 Gene:actrt2 / 448563 XenbaseID:XB-GENE-22041684 Length:375 Species:Xenopus tropicalis


Alignment Length:371 Identity:201/371 - (54%)
Similarity:266/371 - (71%) Gaps:10/371 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPI 72
            |::.|.|||.||||.:|:|.|.||.||:||....:..|:|.||:..|||:.|.|||.||.|.:||
 Frog    11 AVIFDIGSGNCKAGMSGEDLPTAVVPSVVGHLSDRSAMLGAGQQPYYVGEMAMSKRAILDLVFPI 75

  Fly    73 EHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAI 137
            :.||:.:||:|.|||.:.:..||:....||||.||||||||..||.||.:|.||.||.|||||:.
 Frog    76 KEGIVKSWDNMIKIWKYLYKYELKKPSSEHPVFLTEAPLNPLRNRHKMAEIFFENFNVPAMYVSH 140

  Fly   138 QAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFT 202
            ||.|:|||||.|||||||.|.|::|||.||:|.|||||:.:|.:|||.:|.||||:|||.||:|.
 Frog   141 QANLALYASGLTTGIVLDVGAGITHTVAIYDGVALPHAVSKLPVAGRTITQYLMKLLTENGYNFI 205

  Fly   203 TTAEREIVRDIKEKLCYVALD----FEQEMATAAASTSLEKSYELPDGQVITIGNERFRCPESLF 263
            |.|||||||||||||||:|||    :|:.      ...:.|.|.||||.||.|.::.||.||:||
 Frog   206 TAAEREIVRDIKEKLCYIALDPSAEYERN------PKDITKEYTLPDGNVIKIDSQLFRAPEALF 264

  Fly   264 QPSFLGMESCGIHETVYNSIMKCDVDIRKDLYANIVMSGGTTMYPGIADRMQKEITALAPSTIKI 328
            .||.:|:|:.|:...:.|.|.||.:|||:.|.:|:|:|||:|::||..:|:.:|:...||..::|
 Frog   265 SPSNIGLEAPGVQGLINNIIQKCPIDIRRALLSNVVLSGGSTLFPGFDERVLRELEKKAPDGVQI 329

  Fly   329 KIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRK 374
            |::|..:||||||||.|:|:|:.:|::.||.|.||||.||.|||:|
 Frog   330 KVLAATDRKYSVWIGASVLSSMDSFKENWIRKSEYDEFGPSIVHQK 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Act87ENP_001287314.1 PTZ00281 1..376 CDD:173506 201/371 (54%)
actrt2NP_001006111.1 ACTIN 9..375 CDD:214592 200/369 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11937
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.