DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Act87E and Arp53D

DIOPT Version :9

Sequence 1:NP_001287314.1 Gene:Act87E / 48632 FlyBaseID:FBgn0000046 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_477037.2 Gene:Arp53D / 36879 FlyBaseID:FBgn0011743 Length:411 Species:Drosophila melanogaster


Alignment Length:370 Identity:238/370 - (64%)
Similarity:294/370 - (79%) Gaps:5/370 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYP 71
            ||:|:|||||:|||||:.:|.||||||||||||||..|::.....||.:|:.|..||||||||||
  Fly    47 AAVVIDNGSGVCKAGFSPEDTPRAVFPSIVGRPRHLNVLLDSVIGDSVIGEAAARKRGILTLKYP 111

  Fly    72 IEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVA 136
            ||||::.|||:||.:|.|| |..||..|.:.|.||||||||||.||||||:||||.|..||.|||
  Fly   112 IEHGMVKNWDEMEMVWQHT-YELLRADPMDLPALLTEAPLNPKKNREKMTEIMFEHFQVPAFYVA 175

  Fly   137 IQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSF 201
            :||||||||:|||.|||:||||||:||||||||:|||||.:|:|||||||||||.|:|.|||.:.
  Fly   176 VQAVLSLYATGRTVGIVVDSGDGVTHTVPIYEGFALPHACVRVDLAGRDLTDYLCKLLLERGVTM 240

  Fly   202 TTTAEREIVRDIKEKLCYVALDFEQEMATAAASTSLEKSYELPDGQVITIGNERFRCPESLFQPS 266
            .|:|||||||:||||||||::::.:||.....    .::|||||||.|.:|.|||||||:|||||
  Fly   241 GTSAEREIVREIKEKLCYVSMNYAKEMDLHGK----VETYELPDGQKIVLGCERFRCPEALFQPS 301

  Fly   267 FLGMESCGIHETVYNSIMKCDVDIRKDLYANIVMSGGTTMYPGIADRMQKEITALAPSTIKIKII 331
            .||.|..||||..::||..||:|:|||:|||||:||||||:..|..|..:::|.:||.:|:||:.
  Fly   302 LLGQEVMGIHEATHHSITNCDMDLRKDMYANIVLSGGTTMFRNIEHRFLQDLTEMAPPSIRIKVN 366

  Fly   332 APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 376
            |.|:|::|||.|||:||||::||.|||...||:|.|..|||||||
  Fly   367 ASPDRRFSVWTGGSVLASLTSFQNMWIDSLEYEEVGSAIVHRKCF 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Act87ENP_001287314.1 PTZ00281 1..376 CDD:173506 236/368 (64%)
Arp53DNP_477037.2 ACTIN 46..411 CDD:214592 236/368 (64%)
NBD_sugar-kinase_HSP70_actin 47..411 CDD:302596 236/368 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467788
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D283838at33208
OrthoFinder 1 1.000 - - FOG0000057
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11937
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.