DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Act87E and Actrt3

DIOPT Version :9

Sequence 1:NP_001287314.1 Gene:Act87E / 48632 FlyBaseID:FBgn0000046 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001102412.1 Gene:Actrt3 / 365763 RGDID:1561457 Length:371 Species:Rattus norvegicus


Alignment Length:368 Identity:170/368 - (46%)
Similarity:261/368 - (70%) Gaps:4/368 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIE 73
            :|:||||||.|||.||...|:.|:|:|:||.::...... .:::..|||:||.:|..|::.||:|
  Rat     8 VVIDNGSGMIKAGLAGAREPQFVYPNILGRTKNHSPAAD-SKQELRVGDQAQERRSFLSISYPVE 71

  Fly    74 HGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQ 138
            .|:|::|.|||.:|.|.:...|.:.|.:.|||:||..|||.|:|:.::::.||....||.|:::|
  Rat    72 RGLISSWGDMEIMWKHIYDYNLNLNPSDGPVLVTEPALNPLADRQHISEVFFENLGVPAFYMSVQ 136

  Fly   139 AVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTT 203
            |||:|:|:|.|||:||:||.|::..|||:|||.|.|.:.:|::||.|||:|||.:|.:.|.....
  Rat   137 AVLALFAAGFTTGLVLNSGAGITQCVPIFEGYCLSHGVKQLNVAGIDLTNYLMMLLKDDGIMLLR 201

  Fly   204 TAEREIVRDIKEKLCYVALDFEQEMATAAASTSLEKSYELPDGQVITIGNERFRCPESLFQPSFL 268
            |.:|:.|.||||..||||:::::||   ...:::||.|.||||:.:.:..:.|||||:||.|..:
  Rat   202 TGDRKTVTDIKENACYVAMNYDEEM---VKESNVEKMYTLPDGKTVKLRKQVFRCPEALFSPYLV 263

  Fly   269 GMESCGIHETVYNSIMKCDVDIRKDLYANIVMSGGTTMYPGIADRMQKEITALAPSTIKIKIIAP 333
            .:::.||....::||||||.|:|...::||::|||:|.:||:..|:.|::..|||:...::::||
  Rat   264 NVDAPGIDRICFSSIMKCDADLRNSFFSNIILSGGSTSFPGLDKRLIKDVAKLAPANTTVQVVAP 328

  Fly   334 PERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 376
            ||||.|||:|||||||||.||.|||:..|::|.||.|||::||
  Rat   329 PERKISVWMGGSILASLSAFQDMWITAAEFEEVGPNIVHQRCF 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Act87ENP_001287314.1 PTZ00281 1..376 CDD:173506 168/366 (46%)
Actrt3NP_001102412.1 ACTIN 5..371 CDD:214592 168/366 (46%)
NBD_sugar-kinase_HSP70_actin 9..371 CDD:302596 168/365 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D649708at2759
OrthoFinder 1 1.000 - - FOG0000057
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11937
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.