DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Act87E and Arp10

DIOPT Version :9

Sequence 1:NP_001287314.1 Gene:Act87E / 48632 FlyBaseID:FBgn0000046 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001285452.1 Gene:Arp10 / 32969 FlyBaseID:FBgn0031050 Length:378 Species:Drosophila melanogaster


Alignment Length:389 Identity:83/389 - (21%)
Similarity:158/389 - (40%) Gaps:64/389 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLK 69
            |...:|:|.|:...|.|||.:..||.:.|:.|       ||...|.:          ||      
  Fly    10 EKPPIVLDIGTAYTKLGFAAEAYPRKIMPTEV-------VMTTTGIR----------KR------ 51

  Fly    70 YPIEHGIITNWDDMEKIWHH-------TFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 127
                   :.::|..|:::..       .|:..|.|:|:|...:|.|........||.:.:::|..
  Fly    52 -------LFDYDTPEELYDQLVDFLQTIFFKHLLVSPKERKFVLVENVFGSTVLRETLARVLFVH 109

  Fly   128 FNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMK 192
            |:..::......:::|......|.:|:|.|...:..:|::.|..:..|.......|..:...:.:
  Fly   110 FDVSSVLFVPVHLIALSTLAVPTALVVDVGYSETSVMPVFSGVQIMAAFKDQSYGGSAIHAEIKR 174

  Fly   193 ILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAAASTSLEKSYELPDGQVITIGNE--- 254
            .|.|.|...:...| .::.|||.:.|:|.   ..|.|.|.|:....:....||...|...|:   
  Fly   175 QLVESGVKESLLTE-SVLEDIKVRTCFVT---TMERAKARANGDENQPTPAPDVDYIVSDNDAVI 235

  Fly   255 ------RFRCPESLFQPSFLGMESCGIHETVYNSIMKCDVDIRKDLYANIVMSGGTTMYPGIADR 313
                  |....|.:|:.|   .|...:...:..||:.|.:|:|:.|..::.:.||.:|..|:..|
  Fly   236 QVPGLLRESAYEIMFEAS---NERDSLPHLILRSILDCTLDVRRALVESVFLVGGGSMVQGLLAR 297

  Fly   314 MQKEITALAP----------STIKIKII-APPERKYSVWIGGSILASLSTFQQMWISKQEYDES 366
            :::|:..|..          ..::.|.. |..::.::.|:||::..:....|...:.|:.|.:|
  Fly   298 LRQELQHLLTEDPFYAERFHGELQFKFFNAVGKQNFTAWLGGALCGATDLIQTRSLVKETYLKS 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Act87ENP_001287314.1 PTZ00281 1..376 CDD:173506 83/389 (21%)
Arp10NP_001285452.1 ACTIN 11..340 CDD:214592 77/365 (21%)
NBD_sugar-kinase_HSP70_actin 12..367 CDD:302596 82/387 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467824
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11937
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.