DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Act87E and actr6

DIOPT Version :9

Sequence 1:NP_001287314.1 Gene:Act87E / 48632 FlyBaseID:FBgn0000046 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_955990.1 Gene:actr6 / 324822 ZFINID:ZDB-GENE-030131-3543 Length:396 Species:Danio rerio


Alignment Length:409 Identity:115/409 - (28%)
Similarity:196/409 - (47%) Gaps:56/409 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKY 70
            ::.||:|||:...|.|::.:..  :|.|:...|.:...:......:    .||.:...|:..: .
Zfish     1 MSTLVLDNGAYFAKIGYSHEKV--SVIPNSQFRTKTSRLKTFTANQ----LDEIKDPSGLFYI-L 58

  Fly    71 PIEHGIITNWDDMEKIWHHTFYNEL-RVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMY 134
            |.:.|.:.|||...|:|.|.|..|: :|...:..:::||...|..:.:|.|.:|:||.:.     
Zfish    59 PFQKGYLVNWDVQRKVWDHLFGKEMFKVDFADTNIVITEPYFNFCSIQESMNEILFEEYQ----- 118

  Fly   135 VAIQAVLSLYASGRTTG------------IVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 187
              .|:.|.:.|...:..            ||:|||...:|.||...|..:...|.|:::.|:.||
Zfish   119 --FQSALRINAGSLSAHRYFHENNSELCCIVVDSGFSFTHIVPYCRGRKMKGGICRINVGGKLLT 181

  Fly   188 DYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATA---AASTSLEKSYELPD---- 245
            ::|.:|::.|  ......|..::..:||.:|||:.||.::|..|   ....::.|.|.|||    
Zfish   182 NHLKEIISYR--QLHVMDETHVINQVKEDVCYVSQDFYKDMEIAQLKGEDNTVMKDYVLPDFSSI 244

  Fly   246 --------------------GQVITIGNERFRCPESLFQPSFLGMESCGIHETVYNSIMKCDVDI 290
                                .|::.:.||||..||.||.||.:|::..||.|.:.|||.....::
Zfish   245 KKGFCKPLEEMNFTGKYKTGEQILRLTNERFAVPEMLFHPSDIGIQEMGIPEALVNSINNMPEEM 309

  Fly   291 RKDLYANIVMSGGTTMYPGIADRMQKEITALAPSTIKIKIIAPPERKYSVWIGGSILASLSTFQQ 355
            :...|.|||::||.|::||..||:.||:.||||....:.::.|.......|.||.:||....|::
Zfish   310 QPHFYKNIVLTGGNTLFPGFRDRVYKEVRALAPVEYDVSVVLPNNPICYSWEGGKLLAENPDFEE 374

  Fly   356 MWISKQEYDESGPGIVHRK 374
            |.:::.:|:|:|..|...|
Zfish   375 MAVTRDDYEENGHYICEEK 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Act87ENP_001287314.1 PTZ00281 1..376 CDD:173506 115/409 (28%)
actr6NP_955990.1 ACTIN 2..394 CDD:214592 115/408 (28%)
COG5277 2..393 CDD:227602 114/406 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54227
OrthoDB 1 1.010 - - D649708at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.