DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Act87E and Actr6

DIOPT Version :9

Sequence 1:NP_001287314.1 Gene:Act87E / 48632 FlyBaseID:FBgn0000046 Length:376 Species:Drosophila melanogaster
Sequence 2:XP_006241305.1 Gene:Actr6 / 314718 RGDID:1304609 Length:410 Species:Rattus norvegicus


Alignment Length:358 Identity:93/358 - (25%)
Similarity:171/358 - (47%) Gaps:50/358 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 DEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNEL-RVAPEEHPVLLTEAPLNPKANREKM 120
            ||.:...|:..: .|.:.|.:.|||...::|.:.|..|: :|...:..:::||...|..:.:|.|
  Rat    60 DEIKDPSGLFYI-LPFQKGYLVNWDVQRQVWDYLFGKEMYQVDFLDTNIIITEPYFNFTSIQESM 123

  Fly   121 TQIMFETFNAPAMYVAIQAVLSLYASGRTTG------------IVLDSGDGVSHTVPIYEGYALP 173
            .:|:||.:.       .||||.:.|...:..            |::|||...:|.||........
  Rat   124 NEILFEEYQ-------FQAVLRVNAGALSAHRYFRDNPSELCCIIVDSGYSFTHIVPYCRSKKKK 181

  Fly   174 HAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATA---AAST 235
            .||:|:::.|:.||::|.:|::.|  ......|..::..:||.:|||:.||.::|..|   ....
  Rat   182 EAIIRINVGGKLLTNHLKEIISYR--QLHVMDETHVINQVKEDVCYVSQDFYRDMDIAKLKGEDN 244

  Fly   236 SLEKSYELPD------------------------GQVITIGNERFRCPESLFQPSFLGMESCGIH 276
            ::...|.|||                        .|::.:.||||..||.||.||.:|::..||.
  Rat   245 TVMIDYVLPDFSTIKKGFCKPREEMVLSGKYKSGEQILRLANERFAVPEILFNPSDIGIQEMGIP 309

  Fly   277 ETVYNSIMKCDVDIRKDLYANIVMSGGTTMYPGIADRMQKEITALAPSTIKIKIIAPPERKYSVW 341
            |.:..||.....:::...:.|||::||.:::||..:|:..|:..|.|:...:.::.|.......|
  Rat   310 EAIVYSIQNLPEEMQPHFFKNIVLTGGNSLFPGFRERVYSEVRCLTPTDYDVSVVLPENPITYSW 374

  Fly   342 IGGSILASLSTFQQMWISKQEYDESGPGIVHRK 374
            .||.:::....|:.|.:::::|:|:|..:...|
  Rat   375 EGGKLISENDDFEDMVVTREDYEENGHSVCEEK 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Act87ENP_001287314.1 PTZ00281 1..376 CDD:173506 93/358 (26%)
Actr6XP_006241305.1 COG5277 37..407 CDD:227602 92/356 (26%)
ACTIN 38..408 CDD:214592 93/358 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54227
OrthoDB 1 1.010 - - D649708at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.