DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Act87E and Actl7b

DIOPT Version :9

Sequence 1:NP_001287314.1 Gene:Act87E / 48632 FlyBaseID:FBgn0000046 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001020588.1 Gene:Actl7b / 313183 RGDID:1305655 Length:417 Species:Rattus norvegicus


Alignment Length:373 Identity:166/373 - (44%)
Similarity:237/373 - (63%) Gaps:6/373 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG-RPRHQGVMVGMGQKDSYVGDEAQSKRGILTL 68
            ::.|||:|.||..||.|:||:..|.....|.|| |........|...|::|||.|..:....|.|
  Rat    49 KIKALVIDLGSQYCKCGYAGEPRPTYFISSTVGKRSAEMAADAGDTFKETYVGHELLNMEASLKL 113

  Fly    69 KYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAM 133
            ..|::||::.:||.::.||.:.|:..:::.||||.||:::.||:|.:||||..::|||||..|||
  Rat   114 VNPLKHGVVVDWDCIQNIWEYIFHTAMKILPEEHAVLVSDPPLSPTSNREKYAELMFETFGIPAM 178

  Fly   134 YVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 198
            :|..||:||:|:.|:|:|:|::||.||||.|||.||..||....|:|.||.|||:|||::|.|.|
  Rat   179 HVTSQALLSIYSYGKTSGLVVESGHGVSHVVPISEGDLLPGLPSRVDYAGCDLTNYLMQLLNEAG 243

  Fly   199 YSFTTTAEREIVRDIKEKLCYVALDFEQEMATAAASTSLEKSYELPDGQVITIGNERFRCPESLF 263
            :.|:.. ...|:..||:|.||.||..|:||:...  ..|...||||||:|||||.|||||.|.||
  Rat   244 HKFSDD-HLHIIEHIKKKCCYAALLPEEEMSLGL--DELHVDYELPDGKVITIGQERFRCSEMLF 305

  Fly   264 QPSFLGMESCGIHETVYNSIMKCD-VDIRKDLYANIVMSGGTTMYPGIADRMQKEITALAPSTIK 327
            :||.:|....|:.|.....:.:|. ...::::.||:::.||.||..|..:|.|:|::.|.|.. .
  Rat   306 KPSLVGSTQPGLPELTATCLDRCQGTGFKEEMAANVLLCGGCTMLDGFPERFQRELSLLCPGD-S 369

  Fly   328 IKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKC 375
            ..:.|.||||.|||.||||||||..|||:|:||:|::|.|...::.||
  Rat   370 PTVAAAPERKTSVWTGGSILASLQAFQQLWVSKEEFEERGCAAIYSKC 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Act87ENP_001287314.1 PTZ00281 1..376 CDD:173506 166/373 (45%)
Actl7bNP_001020588.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..39
ACTIN 51..417 CDD:214592 164/369 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11937
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.