DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Act87E and Actr10

DIOPT Version :9

Sequence 1:NP_001287314.1 Gene:Act87E / 48632 FlyBaseID:FBgn0000046 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001009602.1 Gene:Actr10 / 299121 RGDID:1306515 Length:417 Species:Rattus norvegicus


Alignment Length:397 Identity:108/397 - (27%)
Similarity:185/397 - (46%) Gaps:60/397 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLK 69
            |..|:|:|.|....|.||||:..||.:.||::.|       .||             .:.|..::
  Rat    12 EKTAVVIDLGEAFTKCGFAGETGPRCIIPSVIKR-------AGM-------------SKPIKVVQ 56

  Fly    70 YPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMY 134
            |.|....:.::  :::..|..::..|.|.|.:..|::.|:.|.|...||.:|:::|:.|..|::.
  Rat    57 YNINTEELYSY--LKEFIHILYFRHLLVNPRDRRVVVIESVLCPSHFRETLTRVLFKYFEVPSVL 119

  Fly   135 VAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTE--- 196
            :|...:::|...|..:.:|||.|...|..:|||||..:.:....|.|.|:.|...|...|.|   
  Rat   120 LAPSHLMALLTLGINSAMVLDCGYRESLVLPIYEGIPVLNCWGALPLGGKALHKELETQLLEQCT 184

  Fly   197 ------RGYSFTT---TAEREIVRDIKEKLCYVALDFEQEMATAAASTSLEKSYELP-------- 244
                  :|.|..:   :....::.|||.:.|:|: |.::.:...||..:::.:.|.|        
  Rat   185 VDTGAAKGQSLPSVMGSVPESVLEDIKVRTCFVS-DLQRGLQIQAAKFNIDGNNERPSPPPNVDY 248

  Fly   245 --DGQVI--TIGNERFRCPESLFQPSFLGMESCGIHETVYNSIMKCDVDIRKDLYANIVMSGGTT 305
              ||:.|  .:|:.|....|.||:..   .|...:...:.:|:::|.||.||.|..|:|:.|||:
  Rat   249 PLDGEKILHVLGSIRDSVVEILFEQD---NEEKSVATLILDSLLQCPVDTRKQLAENLVIIGGTS 310

  Fly   306 MYPGIADRMQKEITALAP--------STIKIKIIAPPERKYSV-WIGGSILASL-STFQQMWISK 360
            |.||...|:..||..|..        .|...:|..||.:...| |:||::..:| .......|||
  Rat   311 MLPGFLHRLLAEIRYLVEKPKYKKTLGTKNFRIHTPPAKANCVAWLGGAVFGALQDILGSRSISK 375

  Fly   361 QEYDESG 367
            :.|:::|
  Rat   376 EYYNQTG 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Act87ENP_001287314.1 PTZ00281 1..376 CDD:173506 108/397 (27%)
Actr10NP_001009602.1 NBD_sugar-kinase_HSP70_actin 13..364 CDD:418402 101/376 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.