DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Act87E and Actrt2

DIOPT Version :9

Sequence 1:NP_001287314.1 Gene:Act87E / 48632 FlyBaseID:FBgn0000046 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001013959.1 Gene:Actrt2 / 298671 RGDID:1359657 Length:377 Species:Rattus norvegicus


Alignment Length:369 Identity:185/369 - (50%)
Similarity:258/369 - (69%) Gaps:2/369 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPI 72
            :::.|||||:||||.:|:..||.|..|:||.|:.:....|..||..:||:||..|:..|.|:.||
  Rat    11 SVIFDNGSGLCKAGLSGEIGPRHVTSSVVGYPKFKASPTGACQKKYFVGEEALFKQETLRLQSPI 75

  Fly    73 EHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAI 137
            |.|:||:|||:||:|.|.|..||.|.|.|.|||:||..|||:.||||..::|||||..||.|::.
  Rat    76 ERGLITSWDDIEKLWRHLFEWELGVKPSERPVLMTEPSLNPRENREKTAEVMFETFEVPAFYLSD 140

  Fly   138 QAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFT 202
            ||||:||:|...||:|:||||||:.||||:|||:||||:.:|.:||:|:|:.|.::|...|.:|.
  Rat   141 QAVLALYSSACVTGLVVDSGDGVTCTVPIFEGYSLPHAVSKLFVAGKDITELLTRLLLASGRAFP 205

  Fly   203 TTAEREIVRDIKEKLCYVALDFEQEMATAAASTSLEKSYELPDGQVITIGNERFRCPESLFQPSF 267
            ...::.:|.|||||||||||:.|:|::..|.....|  |:||||.||.||::.::.||.||.|..
  Rat   206 CPLDKALVDDIKEKLCYVALEPEEELSRRAEDVLRE--YKLPDGNVIYIGDQLYQAPEVLFSPDQ 268

  Fly   268 LGMESCGIHETVYNSIMKCDVDIRKDLYANIVMSGGTTMYPGIADRMQKEITALAPSTIKIKIIA 332
            ||....|:.:...|||.|||.||:|.|:..||:|||:|::.|:.||:.||:..||...:.|||.|
  Rat   269 LGTHGPGLAQMASNSIAKCDADIQKTLFGEIVLSGGSTLFQGLDDRLLKELEQLASKGVPIKITA 333

  Fly   333 PPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 376
            ||:|.:|.|||.||:.|||:|:||||:..::.|.|..:|.|:||
  Rat   334 PPDRWFSTWIGASIVTSLSSFKQMWITAADFKEFGVSVVQRRCF 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Act87ENP_001287314.1 PTZ00281 1..376 CDD:173506 183/367 (50%)
Actrt2NP_001013959.1 NBD_sugar-kinase_HSP70_actin 6..377 CDD:302596 183/367 (50%)
ACTIN 10..377 CDD:214592 183/367 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000057
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11937
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.