DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Act87E and ACTRT1

DIOPT Version :9

Sequence 1:NP_001287314.1 Gene:Act87E / 48632 FlyBaseID:FBgn0000046 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_612146.1 Gene:ACTRT1 / 139741 HGNCID:24027 Length:376 Species:Homo sapiens


Alignment Length:372 Identity:179/372 - (48%)
Similarity:256/372 - (68%) Gaps:3/372 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLK 69
            :|.|::.|||||:||||.:|:..||.|..|::|..:....:..:.|| .:||.||..|...|.|.
Human     8 DVPAVIFDNGSGLCKAGLSGEIGPRHVISSVLGHCKFNVPLARLNQK-YFVGQEALYKYEALHLH 71

  Fly    70 YPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMY 134
            ||||.|::|.||||||:|.|.|..||.|.|.:.|||:||..|||:..|||:.::|||||:.|..|
Human    72 YPIERGLVTGWDDMEKLWKHLFERELGVKPSQQPVLMTEPSLNPREIREKLAEMMFETFSVPGFY 136

  Fly   135 VAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGY 199
            ::..||.:||||...||:|:||||||:.||||:|||:||||:.:|.:||||:|::|.::|...|:
Human   137 LSNHAVAALYASACVTGLVVDSGDGVTCTVPIFEGYSLPHAVTKLCMAGRDITEHLTRLLFASGF 201

  Fly   200 SFTTTAEREIVRDIKEKLCYVALDFEQEMATAAASTSLEKSYELPDGQVITIGNERFRCPESLFQ 264
            :|.....:.:|.:|||||||:||:.|:|:..:..  .:..:|.||||.||..|:|.::.||.||.
Human   202 NFPCILNKAVVNNIKEKLCYIALEPEKELRKSRG--EVLGAYRLPDGHVIHFGDELYQVPEVLFA 264

  Fly   265 PSFLGMESCGIHETVYNSIMKCDVDIRKDLYANIVMSGGTTMYPGIADRMQKEITALAPSTIKIK 329
            |..||:.|.|:.:.|.:||||||.||:..|||:||:|||||:.||:.:|:.||:..||.....||
Human   265 PDQLGIHSPGLSKMVSSSIMKCDTDIQNKLYADIVLSGGTTLLPGLEERLMKEVEQLASKGTPIK 329

  Fly   330 IIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 376
            |.|.|:|.:|.|||.||:.|:|:|:|||::..::.|.|..:|.|:||
Human   330 ITASPDRCFSAWIGASIMTSMSSFKQMWVTSADFKEYGTSVVQRRCF 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Act87ENP_001287314.1 PTZ00281 1..376 CDD:173506 177/370 (48%)
ACTRT1NP_612146.1 ACTIN 9..376 CDD:214592 177/369 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000057
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11937
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.