| Sequence 1: | NP_001287314.1 | Gene: | Act87E / 48632 | FlyBaseID: | FBgn0000046 | Length: | 376 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001264233.1 | Gene: | POTEB / 100996331 | HGNCID: | 33734 | Length: | 544 | Species: | Homo sapiens |
| Alignment Length: | 259 | Identity: | 49/259 - (18%) |
|---|---|---|---|
| Similarity: | 93/259 - (35%) | Gaps: | 76/259 - (29%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 58 EAQSKRGILTLKYPIEHGIITNWDDM--EKIWHHTFYNELRVAPEEHPVLLTEAPLNPK------ 114
Fly 115 -----ANREKMTQIMF-----ETFNAPAMYVAIQAVLSL-YASGRTTGIVLDSGDGVSHTVPIYE 168
Fly 169 GYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAE--REIVRDIKEKLCYVALDFEQEMATA 231
Fly 232 AASTSLEKSYELPDGQVITIGNERFRCPESLFQPSFLGMESCGIHETVYNSIMK-CDVDIRKDL 294 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Act87E | NP_001287314.1 | PTZ00281 | 1..376 | CDD:173506 | 49/259 (19%) |
| POTEB | NP_001264233.1 | ANK | 130..255 | CDD:238125 | 18/81 (22%) |
| ANK 1. /evidence=ECO:0000255|PROSITE-ProRule:PRU00023 | 135..167 | ||||
| ANK repeat | 137..166 | CDD:293786 | |||
| ANK 2. /evidence=ECO:0000255|PROSITE-ProRule:PRU00023 | 168..200 | 7/24 (29%) | |||
| ANK repeat | 168..199 | CDD:293786 | 7/23 (30%) | ||
| ANK | 196..320 | CDD:238125 | 27/151 (18%) | ||
| ANK 3. /evidence=ECO:0000255|PROSITE-ProRule:PRU00023 | 201..233 | 8/33 (24%) | |||
| ANK repeat | 201..232 | CDD:293786 | 7/32 (22%) | ||
| ANK 4. /evidence=ECO:0000255|PROSITE-ProRule:PRU00023 | 234..266 | 4/31 (13%) | |||
| ANK repeat | 234..265 | CDD:293786 | 4/30 (13%) | ||
| ANK 5. /evidence=ECO:0000255|PROSITE-ProRule:PRU00023 | 267..299 | 6/47 (13%) | |||
| ANK repeat | 267..298 | CDD:293786 | 6/46 (13%) | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 332..457 | 11/65 (17%) | |||
| SMC_N | <412..>542 | CDD:330553 | |||
| CCDC144C | 489..>542 | CDD:317340 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_COG5277 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 1 | 0.900 | - | - | OOG6_100127 | |
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 3 | 2.710 | |||||