DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Act87E and POTEB2

DIOPT Version :9

Sequence 1:NP_001287314.1 Gene:Act87E / 48632 FlyBaseID:FBgn0000046 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001264232.1 Gene:POTEB2 / 100287399 HGNCID:48327 Length:544 Species:Homo sapiens


Alignment Length:259 Identity:49/259 - (18%)
Similarity:93/259 - (35%) Gaps:76/259 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 EAQSKRGILTLKYPIEHGIITNWDDM--EKIWHHTFYNELRVAPEEHPVLLTEAPLNPK------ 114
            :.|....:|.|   :|||...|..|.  ....|:..|||.::..:  .:||..|.:..|      
Human   178 QCQEDECVLML---LEHGADGNIQDEYGNTALHYAIYNEDKLMAK--ALLLYGADIESKNKCGLT 237

  Fly   115 -----ANREKMTQIMF-----ETFNAPAMYVAIQAVLSL-YASGRTTGIVLDSGDGVSHTVPIYE 168
                 .:.:|...:.|     ...||...|.....:|:: ..|.....::|:....||..     
Human   238 PLLLGVHEQKQEVVKFLIKKKANLNALDRYGRTALILAVCCGSASIVNLLLEQNVDVSSQ----- 297

  Fly   169 GYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAE--REIVRDIKEKLCYVALDFEQEMATA 231
                       ||:|:          |.|.|:.::...  .|::.|.|||         |.:..:
Human   298 -----------DLSGQ----------TAREYAVSSHHHVICELLSDYKEK---------QMLKIS 332

  Fly   232 AASTSLEKSYELPDGQVITIGNERFRCPESLFQPSFLGMESCGIHETVYNSIMK-CDVDIRKDL 294
            :.:::.|:..:|...:    .::|.:..|: .||..:..|.         .|.| ||.::.:::
Human   333 SENSNPEQDLKLTSEE----ESQRLKVSEN-SQPEKMSQEP---------EINKDCDREVEEEI 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Act87ENP_001287314.1 PTZ00281 1..376 CDD:173506 49/259 (19%)
POTEB2NP_001264232.1 ANK 130..255 CDD:238125 18/81 (22%)
ANK 1 135..167
ANK repeat 137..166 CDD:293786
ANK 2 168..200 7/24 (29%)
ANK repeat 168..199 CDD:293786 7/23 (30%)
ANK 196..320 CDD:238125 27/151 (18%)
ANK 3 201..233 8/33 (24%)
ANK repeat 201..232 CDD:293786 7/32 (22%)
ANK 4 234..266 4/31 (13%)
ANK repeat 234..265 CDD:293786 4/30 (13%)
ANK 5 267..299 6/47 (13%)
ANK repeat 267..298 CDD:293786 6/46 (13%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 332..457 11/65 (17%)
SMC_N <412..>542 CDD:330553
CCDC144C 489..>542 CDD:317340
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100127
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.710

Return to query results.
Submit another query.