DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5704 and BDG1

DIOPT Version :10

Sequence 1:NP_652068.1 Gene:CG5704 / 48613 FlyBaseID:FBgn0026570 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_001323396.1 Gene:BDG1 / 842775 AraportID:AT1G64670 Length:524 Species:Arabidopsis thaliana


Alignment Length:115 Identity:34/115 - (29%)
Similarity:55/115 - (47%) Gaps:12/115 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 NRNERPILAIHGWLDNLGTF--DRLIPLLPD----YLGVLCIDLPGHGRSSHLPPGMYYSVYEYV 86
            |:.:..::.|||:|.: .||  :.|.|...|    ....|.:||.|:|:|.. |....|::.|::
plant   234 NKAQENVVFIHGFLSS-STFWTETLFPNFSDSAKSNYRFLAVDLLGYGKSPK-PNDSLYTLKEHL 296

  Fly    87 FTIP-LVMKEYGWSKVSLIGHSLGGVLSFIYASLAPHTVDMIVSLDILLP 135
            ..|. .|:.::......|:.||||.:|:...|...|   ..|.||.:|.|
plant   297 EMIERSVISQFRLKTFHLVAHSLGCILALALAVKHP---GAIKSLTLLAP 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5704NP_652068.1 MenH 32..301 CDD:440361 33/111 (30%)
BDG1NP_001323396.1 PLN03087 56..517 CDD:215567 34/115 (30%)

Return to query results.
Submit another query.