DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5704 and AT1G52750

DIOPT Version :10

Sequence 1:NP_652068.1 Gene:CG5704 / 48613 FlyBaseID:FBgn0026570 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_175684.3 Gene:AT1G52750 / 841708 AraportID:AT1G52750 Length:633 Species:Arabidopsis thaliana


Alignment Length:148 Identity:31/148 - (20%)
Similarity:54/148 - (36%) Gaps:32/148 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SHQTVALASKAKSPKPKR-----GKLDKEKMTALEKHVSFFDRNKDGTVYPWETY-QGFRAL--G 58
            |:||...::......|..     .||.||:...:|:.|....::: ||....:|. |..:|.  .
plant   150 SNQTCCSSTSQSQGSPTEVGGEIEKLRKERRALMEEMVELQQQSR-GTARHVDTVNQRLKAAEQR 213

  Fly    59 TGRLLAAFVAIFINMGLSKKTRPGKGFSPLFPIDVKNSHLCMHGSDTDVYDDDGRFVESKFEEIF 123
            ..:||:....:|.|.|..::.:..||                       .:..|.....|..:.|
plant   214 QKQLLSFLAKLFQNRGFLERLKNFKG-----------------------KEKGGALGLEKARKKF 255

  Fly   124 NKHARTHKDALTAEEIQK 141
            .||.:..:|:.|..|:.|
plant   256 IKHHQQPQDSPTGGEVVK 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5704NP_652068.1 MenH 32..301 CDD:440361 22/113 (19%)
AT1G52750NP_175684.3 MenH 356..623 CDD:440361
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.