DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5704 and AT1G52510

DIOPT Version :10

Sequence 1:NP_652068.1 Gene:CG5704 / 48613 FlyBaseID:FBgn0026570 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_175660.2 Gene:AT1G52510 / 841682 AraportID:AT1G52510 Length:380 Species:Arabidopsis thaliana


Alignment Length:70 Identity:13/70 - (18%)
Similarity:30/70 - (42%) Gaps:20/70 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 QKMLKTNRDPFDITGWLSDYGEWKILHTLAQDKNGLLSEKSVRAIYDGSLFHQLEKKRSSSSSRG 204
            |.:..|::..|.:..||.     .:|:.:....|.||.:            ||:.::   :.::.
plant    14 QILFVTSKRYFFVLMWLD-----PLLYNIISTHNSLLKK------------HQIIQE---TKTKE 58

  Fly   205 KKQKL 209
            :|:|:
plant    59 RKKKI 63

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5704NP_652068.1 MenH 32..301 CDD:440361 13/70 (19%)
AT1G52510NP_175660.2 PRK03592 <103..367 CDD:481245
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.