powered by:
Protein Alignment Hsp70Bc and ANKRD45
DIOPT Version :9
Sequence 1: | NP_650209.1 |
Gene: | Hsp70Bc / 48583 |
FlyBaseID: | FBgn0013279 |
Length: | 641 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_016856612.1 |
Gene: | ANKRD45 / 339416 |
HGNCID: | 24786 |
Length: | 286 |
Species: | Homo sapiens |
Alignment Length: | 138 |
Identity: | 33/138 - (23%) |
Similarity: | 60/138 - (43%) |
Gaps: | 29/138 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 472 IEVTFDLDANGILNVSAKEMSTGKAKNITIKNDKGRLSQAEIDRMVNEAEKYADEDEKHRQRITS 536
:|:..|::|.......|:::: .|.||.|....::.|: :
Human 150 VELDVDIEALNFREERARDVA-------------ARYSQTECVEFLDWAD--------------A 187
Fly 537 RNALESYVFNVKQSV--EQAPAGKLDEADKNSVLDKCNETIRWLDSNTTAEKEEFDHKMEELTRH 599
|..|:.|:..|..:| .:..:|||.:.|||::|..|.....||:::|.|...|...:.::|...
Human 188 RLTLKKYIAKVSLAVTDTEKGSGKLLKEDKNTILSACRAKNEWLETHTEASINELFEQRQQLEDI 252
Fly 600 CSPIMTKM 607
.:||.|||
Human 253 VTPIFTKM 260
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0443 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.