DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp70Aa and ankrd45

DIOPT Version :9

Sequence 1:NP_731651.1 Gene:Hsp70Aa / 48581 FlyBaseID:FBgn0013275 Length:642 Species:Drosophila melanogaster
Sequence 2:NP_001018606.1 Gene:ankrd45 / 553808 ZFINID:ZDB-GENE-050522-311 Length:224 Species:Danio rerio


Alignment Length:100 Identity:22/100 - (22%)
Similarity:53/100 - (53%) Gaps:3/100 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   514 DRMVNEAEKYADED-EKHRQRITSRNALESYVFNVKQAV--EQAPAGKLDEADKNSVLDKCNDTI 575
            ::.|:.|.:|...| .::.....::..|::::..|:..|  ::...|||::.|||..::.|:...
Zfish   115 EKAVDVARRYDKLDCAEYLAWAEAKQNLQAFIQEVRAIVADQEKVQGKLNKEDKNICINTCSAKS 179

  Fly   576 RWLDSNTTAEKEEFDHKLEELTRHCSPIMTKMHQQ 610
            .|:::..||..:.|..:.:.|....:|::.|::.|
Zfish   180 EWINNTRTATAQVFIEQKKLLEDVLAPVLLKLNAQ 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp70AaNP_731651.1 PTZ00009 2..642 CDD:240227 21/99 (21%)
HSPA1-2_6-8-like_NBD 3..379 CDD:212675
ankrd45NP_001018606.1 ANK <42..133 CDD:238125 4/17 (24%)
ANK repeat 46..78 CDD:293786
Ank_2 51..143 CDD:289560 4/27 (15%)
ANK repeat 80..111 CDD:293786
ANK repeat 113..143 CDD:293786 4/27 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0443
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.