DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp70Aa and ANKRD45

DIOPT Version :9

Sequence 1:NP_731651.1 Gene:Hsp70Aa / 48581 FlyBaseID:FBgn0013275 Length:642 Species:Drosophila melanogaster
Sequence 2:XP_016856612.1 Gene:ANKRD45 / 339416 HGNCID:24786 Length:286 Species:Homo sapiens


Alignment Length:138 Identity:34/138 - (24%)
Similarity:60/138 - (43%) Gaps:29/138 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   472 IEVTFDLDANGILNVSAKEMSTGKAKNITIKNDKGRLSQAEIDRMVNEAEKYADEDEKHRQRITS 536
            :|:..|::|.......|::::             .|.||.|....::.|:              :
Human   150 VELDVDIEALNFREERARDVA-------------ARYSQTECVEFLDWAD--------------A 187

  Fly   537 RNALESYVFNVKQAV--EQAPAGKLDEADKNSVLDKCNDTIRWLDSNTTAEKEEFDHKLEELTRH 599
            |..|:.|:..|..||  .:..:|||.:.|||::|..|.....||:::|.|...|...:.::|...
Human   188 RLTLKKYIAKVSLAVTDTEKGSGKLLKEDKNTILSACRAKNEWLETHTEASINELFEQRQQLEDI 252

  Fly   600 CSPIMTKM 607
            .:||.|||
Human   253 VTPIFTKM 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp70AaNP_731651.1 PTZ00009 2..642 CDD:240227 34/138 (25%)
HSPA1-2_6-8-like_NBD 3..379 CDD:212675
ANKRD45XP_016856612.1 ANK repeat 58..94 CDD:293786
ANK 94..>182 CDD:238125 8/44 (18%)
Ank_4 97..150 CDD:290365 34/138 (25%)
ANK repeat 97..127 CDD:293786
ANK repeat 129..160 CDD:293786 3/9 (33%)
Ank_4 130..182 CDD:290365 8/44 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0443
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.