DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp60B and MKKS

DIOPT Version :9

Sequence 1:NP_524925.1 Gene:Hsp60B / 48572 FlyBaseID:FBgn0011244 Length:648 Species:Drosophila melanogaster
Sequence 2:NP_061336.1 Gene:MKKS / 8195 HGNCID:7108 Length:570 Species:Homo sapiens


Alignment Length:659 Identity:119/659 - (18%)
Similarity:188/659 - (28%) Gaps:277/659 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 VDILADAVAVTMGPKGRSVIVERPWTSPKITKDGF-----TVARSIALKDQ----HMNLGAKLVQ 93
            :.:|...|....||.||.          |...:||     |.::|.||...    |..|  |::.
Human    26 LSVLKRIVTSCYGPSGRL----------KQLHNGFGGYVCTTSQSSALLSHLLVTHPIL--KILT 78

  Fly    94 DVADNTNESAGD-GTTTATVLARAIAKEGFNQITMGANPVEIRR------------------GVM 139
            ....|...|..| |..||.:....|.    |...:|..|..:.|                  |..
Human    79 ASIQNHVSSFSDCGLFTAILCCNLIE----NVQRLGLTPTTVIRLNKHLLSLCISYLKSETCGCR 139

  Fly   140 LAVD---------VVKDKLKEMSKAVETREEIQQVATL-----------SANGDTEIGRLIGEAT 184
            :.||         :|:..|......:.||:|.:.|:.|           :|.|...:|:.:    
Human   140 IPVDFSSTQILLCLVRSILTSKPACMLTRKETEHVSALILRAFLLTIPENAEGHIILGKSL---- 200

  Fly   185 DKVGPRGTITVKDGKRLKDELNIIQGLRFDNGYVSPFFVNSSKGSKVEFANALVMISLKKITGLS 249
                    |....|:|:.|. .::.|:..:.             |:|:.   :.::.:||.|.| 
Human   201 --------IVPLKGQRVIDS-TVLPGILIEM-------------SEVQL---MRLLPIKKSTAL- 239

  Fly   250 QIVKGLEQSLRQRRPLIIIAEDISGEALNALVLNKLRLGLQVCAVKSPSYGHHRKELIGDISAAT 314
                                              |:.|   .|..           |.||.|...
Human   240 ----------------------------------KVAL---FCTT-----------LSGDTSDTG 256

  Fly   315 GATIFGDDINYS-KMEEAKLEDLGQVGEAVISKDSTMLLQGKPKTGLLEMRIQQIQDELAEKQIK 378
            ..|:.   ::|. .:|.|.|:.|..:|..:||....::                    |.:|.|.
Human   257 EGTVV---VSYGVSLENAVLDQLLNLGRQLISDHVDLV--------------------LCQKVIH 298

  Fly   379 PEQRDRLRQR------------LSALTKGVAVLHIGG---------GSEVEV------------- 409
            |..:..|...            :..|||......||.         ||..:|             
Human   299 PSLKQFLNMHRIIAIDRIGVTLMEPLTKMTGTQPIGSLGSICPNSYGSVKDVCTAKFGSKHFFHL 363

  Fly   410 --NE----------KKDRVVDALNAT-RAAI--------EEGIVPGGGTAFLRCIPYLQE----- 448
              ||          :.|...|.|..| :.|:        |...:.|||........|::.     
Human   364 IPNEATICSLLLCNRNDTAWDELKLTCQTALHVLQLTLKEPWALLGGGCTETHLAAYIRHKTHND 428

  Fly   449 ----LKTE---SADLQKGVDIVCNALRMPCQTIAQNAG---------------VDGPMVV----- 486
                ||.:   ..:||...:..|:||.....::..:.|               .|.|.|.     
Human   429 PESILKDDECTQTELQLIAEAFCSALESVVGSLEHDGGEILTDMKYGHLWSVQADSPCVANWPDL 493

  Fly   487 -----AKVLNGSEDYGYDAMGDEYCRLVEKGIIDPTKVLRTAITDAAGVASLLSTTEVVITDSRN 546
                 ..:.|..|:..:     .:.|...:..: |...|.   .:|.|.||.|:.          
Human   494 LSQCGCGLYNSQEELNW-----SFLRSTRRPFV-PQSCLP---HEAVGSASNLTL---------- 539

  Fly   547 DDLLSKLSG 555
            |.|.:||||
Human   540 DCLTAKLSG 548

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp60BNP_524925.1 PTZ00114 9..558 CDD:185455 119/659 (18%)
GroEL 22..543 CDD:239460 113/645 (18%)
MKKSNP_061336.1 Cpn60_TCP1 29..569 CDD:278544 119/656 (18%)
chaperonin_like 32..476 CDD:295468 99/560 (18%)
Substrate-binding apical domain 198..370 42/272 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0459
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.