DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp60B and CCT3

DIOPT Version :9

Sequence 1:NP_524925.1 Gene:Hsp60B / 48572 FlyBaseID:FBgn0011244 Length:648 Species:Drosophila melanogaster
Sequence 2:NP_001189236.1 Gene:CCT3 / 42029 FlyBaseID:FBgn0015019 Length:544 Species:Drosophila melanogaster


Alignment Length:599 Identity:132/599 - (22%)
Similarity:238/599 - (39%) Gaps:141/599 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 SKDVRFGSGVRAMM--IRGVDILADAVAVTMGPKGRSVIVERPWTSPKITKDGFTVARSIALKDQ 83
            |::.:..||.:..:  |:....:||.:...:||:....::..|.....:|.||..:.|.|.:  |
  Fly    12 SQNTKRESGRKVQLENIQAGKAIADVIRTCLGPQAMLKMLMDPMGGIVMTNDGNAILREITV--Q 74

  Fly    84 HMNLGAKLVQDVADNTNESAGDGTTTATVLARAI--AKEGFNQITMGANPVEIRRGVMLAV-DVV 145
            |.  .||.:.::|...:|..|||||:..|||..:  |.|.|.|  ...:|..|.|....|: |:|
  Fly    75 HP--AAKSMIEIARTQDEEVGDGTTSVIVLAGEMLAAAEPFLQ--QQIHPTVIIRAYREALEDIV 135

  Fly   146 KDKLKEMSKAVETREEIQQVATLSANGDTE-IGR----LIGEATDKVGPRGTITVKDGKRLKDEL 205
            .....::|..::.:::.:....:.|...|: ||:    .:..|.|.|   .|:|:.:..||:   
  Fly   136 GHLQSQLSIQLDVKDKAKMADVVKACVGTKFIGKWSDLAVKIALDAV---ETVTLSENGRLE--- 194

  Fly   206 NIIQGLRFDNGYVSPFFVNSSKGSKVEFANALVMISLKKITG----LSQIVKGLEQSLRQRRPLI 266
                             |:..:.:|||           ||.|    .|.::||           :
  Fly   195 -----------------VDIKRYAKVE-----------KIPGGAIEESCVLKG-----------V 220

  Fly   267 IIAEDISGEALNALVLNKLRLGLQVCAVKSPSYGHHRKELIGDISAATGATIFGDDINYSKMEEA 331
            :|.:|::...:..|:.|. |:.|..|:::      ::|   |:  :.|...|.|:. ::::|.:.
  Fly   221 MINKDVTHPKMRRLIENP-RIVLLDCSLE------YKK---GE--SQTNVEIIGEQ-DFTRMLQI 272

  Fly   332 KLEDLGQVGEAVISKDSTMLLQGKP----------KTGLLEMR-----------------IQQIQ 369
            :.|.:.::...:|:....::...|.          |.|:..:|                 |....
  Fly   273 EEEFVQRICADIIAVKPDLVFTEKGVSDLAQHYLLKAGITAIRRLRKTDNLRIARACGATIVNRT 337

  Fly   370 DELAEKQIKP-----EQRDRLRQRLSALT-----KGVAVLHIGGGSEVEVNEKKDRVVDALNATR 424
            :||.||.:..     |.:....:..:.:|     |...:| :.|.|:..:||.:..:.|||:..|
  Fly   338 EELTEKDVGTGAGLFEVKKIGDEYFTFVTECKEPKACTIL-LRGASKDILNETERNLQDALHVAR 401

  Fly   425 -AAIEEGIVPGGGTAFLRCIPYLQELKTESADLQKG-VDIVCNALRMPCQTIAQNAGVDGPMVV- 486
             ..:|..:|.|||...:.....|...:.      || ...|.:||.:..:|:|||.|.:....: 
  Fly   402 NLVLEPRLVAGGGAVEMAASQLLTRKQV------KGPYTAVAHALEIIPRTLAQNCGANTIRALT 460

  Fly   487 ---AKVLNGSED----YGYDAMGDEYCRLVEKGIIDPTKVLRTAITDAAGVASLLSTTEVVITDS 544
               ||..:.:.|    :|.|....|...:..|.|.:|..|.......|...|.||         .
  Fly   461 ALRAKHASHTGDGVCAWGIDGESGEIVDMNVKNIWEPLAVKLQTYKTAVETAILL---------L 516

  Fly   545 RNDDLLSKLSGAGG 558
            |.||::|.....||
  Fly   517 RIDDIVSGSKKRGG 530

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp60BNP_524925.1 PTZ00114 9..558 CDD:185455 130/597 (22%)
GroEL 22..543 CDD:239460 125/581 (22%)
CCT3NP_001189236.1 chap_CCT_gamma 7..528 CDD:274085 130/595 (22%)
TCP1_gamma 7..524 CDD:239453 129/591 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453468
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0459
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.