DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sam-S and MAT1A

DIOPT Version :9

Sequence 1:NP_524923.1 Gene:Sam-S / 48552 FlyBaseID:FBgn0005278 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_000420.1 Gene:MAT1A / 4143 HGNCID:6903 Length:395 Species:Homo sapiens


Alignment Length:384 Identity:275/384 - (71%)
Similarity:341/384 - (88%) Gaps:1/384 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 YDMEDGATFLFTSESVGEGHPDKMCDQISDAILDAHLKQDPNAKVACETVAKTGMILLCGEITSK 85
            :.:.:| .|:|||||||||||||:|||||||:||||||||||||||||||.||||:||||||||.
Human    11 HSLSEG-VFMFTSESVGEGHPDKICDQISDAVLDAHLKQDPNAKVACETVCKTGMVLLCGEITSM 74

  Fly    86 AVVDYQKVVRETVQHIGYDDSSKGFDWKTLNLLVAIEQQSPNIANGVHINREEEDVGAGDQGIMF 150
            |:||||:|||:|::|||||||:||||:||.|:|||:|||||:||..||::|.||||||||||:||
Human    75 AMVDYQRVVRDTIKHIGYDDSAKGFDFKTCNVLVALEQQSPDIAQCVHLDRNEEDVGAGDQGLMF 139

  Fly   151 GYATDETEECMPLTVVLAHKLNEKIAELRRSDVFWWARPDSKTQVTCEYLFNQGSAVPKRVHTIV 215
            ||||||||||||||::||||||.::|:||||.:..|.|||||||||.:|:.:.|:.:|.|:||||
Human   140 GYATDETEECMPLTIILAHKLNARMADLRRSGLLPWLRPDSKTQVTVQYMQDNGAVIPVRIHTIV 204

  Fly   216 VSMQHSEKISLETLRSEVMEKVVKVVIPAKYIDANTIVHINPCGLFVIGGPMGDAGLTGRKIIVD 280
            :|:||:|.|:||.:|..:.|:|::.|:||||:|.:|:.|:.|.|.||||||.||||:||||||||
Human   205 ISVQHNEDITLEEMRRALKEQVIRAVVPAKYLDEDTVYHLQPSGRFVIGGPQGDAGVTGRKIIVD 269

  Fly   281 TYGGWGAHGGGAFSGKDFTKVDRSAAYAARWVAKSLVKAGLCKRCLVQVSYAIGLAEPLSITVFD 345
            |||||||||||||||||:||||||||||||||||||||||||:|.|||||||||:||||||::|.
Human   270 TYGGWGAHGGGAFSGKDYTKVDRSAAYAARWVAKSLVKAGLCRRVLVQVSYAIGVAEPLSISIFT 334

  Fly   346 YGTSHKSQKELLDIIRRNFDLRPGKIVKDLNLRQPIYQRTSTYGHFGRAGFSWEEAKPL 404
            ||||.|:::||||::.:|||||||.||:||:|::||||:|:.||||||:.|.||..:.|
Human   335 YGTSQKTERELLDVVHKNFDLRPGVIVRDLDLKKPIYQKTACYGHFGRSEFPWEVPRKL 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sam-SNP_524923.1 PTZ00104 28..408 CDD:240268 274/377 (73%)
S-AdoMet_synt_N 28..125 CDD:278846 79/96 (82%)
S-AdoMet_synt_M 140..261 CDD:280867 73/120 (61%)
S-AdoMet_synt_C 263..399 CDD:280868 107/135 (79%)
MAT1ANP_000420.1 PTZ00104 12..393 CDD:240268 274/381 (72%)
Flexible loop. /evidence=ECO:0000250|UniProtKB:P0A817 113..125 7/11 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147327
Domainoid 1 1.000 240 1.000 Domainoid score I2265
eggNOG 1 0.900 - - E1_COG0192
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 606 1.000 Inparanoid score I937
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG61243
OrthoDB 1 1.010 - - D357186at33208
OrthoFinder 1 1.000 - - FOG0000746
OrthoInspector 1 1.000 - - otm41944
orthoMCL 1 0.900 - - OOG6_100388
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R708
SonicParanoid 1 1.000 - - X478
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.700

Return to query results.
Submit another query.