DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NOTCH4 and Dl

DIOPT Version :9

Sequence 1:NP_004548.3 Gene:NOTCH4 / 4855 HGNCID:7884 Length:2003 Species:Homo sapiens
Sequence 2:NP_001247193.1 Gene:Dl / 42313 FlyBaseID:FBgn0000463 Length:833 Species:Drosophila melanogaster


Alignment Length:476 Identity:154/476 - (32%)
Similarity:212/476 - (44%) Gaps:81/476 - (17%)


- Green bases have known domain annotations that are detailed below.


Human   573 FHCKCLPGFEGPRCQTEVDECLSDPCPVGASCLDLPGAFFCLCPSGFTGQLCEVPLCAPNLCQPK 637
            |...|...:.|..|   ...|.......|.|.....|...||  :|:.|..|.:|.||..     
  Fly   180 FRVTCDLNYYGSGC---AKFCRPRDDSFGHSTCSETGEIICL--TGWQGDYCHIPKCAKG----- 234

Human   638 QICKDQKDKANCLCPDGSPGCAPPEDNCTCHHGHCQR-SSCVCDVGWTGPECEAELGGCISAP-C 700
                                         |.||||.: :.|||.:||.|..|..    |:..| |
  Fly   235 -----------------------------CEHGHCDKPNQCVCQLGWKGALCNE----CVLEPNC 266

Human   701 AHGGTCYPQPSGYNCTCPTGYTGPTCSEEMTAC-HSGPCLNGGSC-NPSPGGYYCTCPPSHTGPQ 763
            .| ||| .:|  :.|.|..|:.|..|::::..| :..||.|||:| |...|.|.|.|.|.::|..
  Fly   267 IH-GTC-NKP--WTCICNEGWGGLYCNQDLNYCTNHRPCKNGGTCFNTGEGLYTCKCAPGYSGDD 327

Human   764 CQTSTDYCVS--APCFNGGTCVNRPGT---FSCLCAMGFQGPRCEGKLRPSCADSPCRNRATCQD 823
            |:.....|.:  .||.|||||::.|.|   :.|.||.|:.|..||.|:. :|:|.|| ::..|::
  Fly   328 CENEIYSCDADVNPCQNGGTCIDEPHTKTGYKCHCANGWSGKMCEEKVL-TCSDKPC-HQGICRN 390

Human   824 -------SPQGPRCLCPTGYTGGSCQTLMDLCAQKPCPRNSHCLQTGPSFHCLCLQGWTGPLCNL 881
                   ..||.:|.||.||:|.:|...:|.|:..||.....|   .||..|:|..|::|..|..
  Fly   391 VRPGLGSKGQGYQCECPIGYSGPNCDLQLDNCSPNPCINGGSC---QPSGKCICPAGFSGTRCET 452

Human   882 PLSSCQKAALSQGIDVSSLCHNGGLCVDSGPSYFCHCPPGFQGSLCQDHVNPCESRPCQNGATCM 946
            .:..|          :...|.|||.|:|....|.|.|.|||.|:.|...|:.|..|||.||.||:
  Fly   453 NIDDC----------LGHQCENGGTCIDMVNQYRCQCVPGFHGTHCSSKVDLCLIRPCANGGTCL 507

Human   947 AQPSGYLCQCAPGYDGQNCSKELDACQSQPCHNHGTCTPKPGGFHCACPPGFVGLRCEGDVDECL 1011
            ...:.|.|.|..|:.|::||.::|.|.|.||||.|||..:...|.|.|..||.|.:|:.:..:.:
  Fly   508 NLNNDYQCTCRAGFTGKDCSVDIDECSSGPCHNGGTCMNRVNSFECVCANGFRGKQCDEESYDSV 572

Human  1012 DQPCHPTGT---AACHSLANA 1029
            ....|..|.   |....|.||
  Fly   573 TFDAHQYGATTQARADGLTNA 593

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NOTCH4NP_004548.3 EGF_CA 194..232 CDD:238011
EGF_CA 314..353 CDD:238011
EGF_CA 432..473 CDD:238011
EGF_CA 475..511 CDD:238011
EGF_CA 515..549 CDD:238011
EGF_CA 551..587 CDD:238011 3/13 (23%)
EGF_CA 590..625 CDD:238011 8/34 (24%)
EGF_CA <699..726 CDD:238011 11/27 (41%)
EGF_CA <736..765 CDD:238011 13/29 (45%)
EGF_CA 769..803 CDD:238011 15/38 (39%)
EGF_CA <899..928 CDD:238011 13/28 (46%)
EGF_CA 931..965 CDD:238011 14/33 (42%)
EGF_CA 970..1004 CDD:238011 16/33 (48%)
Notch 1165..1203 CDD:321927
LNR 1 1170..1213
NL 1207..1245 CDD:197463
LNR 2 1214..1250
Notch 1249..1285 CDD:306554
LNR 3 1251..1294
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1347..1371
NODP 1380..>1420 CDD:311559
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1485..1508
ANK 1586..1721 CDD:238125
ANK repeat 1586..1630 CDD:293786
ANK 1 1633..1665
ANK repeat 1634..1664 CDD:293786
ANK 1661..1787 CDD:238125
ANK repeat 1666..1698 CDD:293786
ANK 2 1666..1698
ANK 3 1700..1732
ANK repeat 1700..1731 CDD:293786
ANK 4 1733..1765
ANK repeat 1733..1764 CDD:293786
Ank_5 1753..>1851 CDD:330893
ANK 5 1766..1798
ANK repeat 1766..1797 CDD:293786
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1900..1927
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1968..2003
DlNP_001247193.1 MNNL 23..96 CDD:284966
DSL 164..226 CDD:279722 12/50 (24%)
EGF_CA 291..329 CDD:238011 14/37 (38%)
EGF_CA 337..372 CDD:238011 14/34 (41%)
EGF_CA 453..488 CDD:238011 14/44 (32%)
EGF_CA 492..526 CDD:238011 14/33 (42%)
EGF_CA 529..564 CDD:238011 16/34 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144844
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.