DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrb87F and RBM19

DIOPT Version :9

Sequence 1:NP_001163602.1 Gene:Hrb87F / 48535 FlyBaseID:FBgn0004237 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_001140170.1 Gene:RBM19 / 9904 HGNCID:29098 Length:960 Species:Homo sapiens


Alignment Length:189 Identity:56/189 - (29%)
Similarity:85/189 - (44%) Gaps:40/189 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 AEQNDSNGNYDDGEEITEPEQLR--KLFIGGLDYRTTDDGLKAHFEKWGNIVDVVVMKDPKTKR- 63
            |:.:.:....::.||..|.|.|.  .|||..|::.||::.||..|.|.|.:....:.| .|.|. 
Human   706 ADNSSAKMEEEEEEEEEEEESLPGCTLFIKNLNFDTTEEKLKEVFSKVGTVKSCSISK-KKNKAG 769

  Fly    64 ---SRGFGFITYSQSYMIDNAQNA----RPHKIDG---------RTVEP------KRAVPRQEID 106
               |.||||:.|.:.   :.||.|    :.|.:||         |..:|      |:.|||::  
Human   770 VLLSMGFGFVEYRKP---EQAQKALKQLQGHVVDGHKLEVRISERATKPAVTLARKKQVPRKQ-- 829

  Fly   107 SPNAGATVKKLFVGGLR-DDHDEECLREYFKDFGQIVSVNIVSD-KDTGKKRGFAFIEF 163
                  |..|:.|..:. ..|..| :||.|..||::.:|.:... ..||..|||.|::|
Human   830 ------TTSKILVRNIPFQAHSRE-IRELFSTFGELKTVRLPKKMTGTGTHRGFGFVDF 881

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hrb87FNP_001163602.1 RRM1_hnRNPA_like 25..102 CDD:241022 30/99 (30%)
RRM_SF 116..188 CDD:302621 17/50 (34%)
RBM19NP_001140170.1 RRM <2..>104 CDD:223796
RRM1_RBM19 2..77 CDD:241008
RRM_u2 82..286 CDD:293257
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 85..119
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 149..294
RRM <270..450 CDD:223796
RRM2_RMB19 294..365 CDD:240946
RRM <400..>500 CDD:223796
RRM3_RBM19 400..478 CDD:241011
RRM 477..801 CDD:223796 30/98 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 491..513
RRM4_RBM19 587..658 CDD:241013
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 667..729 6/22 (27%)
RRM5_RBM19_like 730..809 CDD:240764 26/82 (32%)
RRM6_RBM19 832..910 CDD:241015 17/51 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.