DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrb87F and PUB1

DIOPT Version :9

Sequence 1:NP_001163602.1 Gene:Hrb87F / 48535 FlyBaseID:FBgn0004237 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_014382.1 Gene:PUB1 / 855716 SGDID:S000004961 Length:453 Species:Saccharomyces cerevisiae


Alignment Length:299 Identity:74/299 - (24%)
Similarity:111/299 - (37%) Gaps:78/299 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 AEQNDSNGNYDD-----------GEEITEPEQLRKLFIGGLDYRTTDDGLKAHFEKWGNIVDVVV 55
            :||.:.|...:|           |.|.::    |.|::|.||...|:|.||.:|:..|.|.::.:
Yeast    46 SEQAEDNQGENDPSVVPANAITGGRETSD----RVLYVGNLDKAITEDILKQYFQVGGPIANIKI 106

  Fly    56 MKDPKTKRSRGFGFITYSQSYMIDNA-QNARPHKIDGRTVEPKRAVPRQEIDSPNAGATVKKLFV 119
            |.| |..::..:.|:.|.||:..:.| |.....:|:...|:...|...|:..|.:    ...|||
Yeast   107 MID-KNNKNVNYAFVEYHQSHDANIALQTLNGKQIENNIVKINWAFQSQQSSSDD----TFNLFV 166

  Fly   120 GGLRDDHDEECLREYFKDFGQIVSVNIVSDKDTGKKRGFAFIEFDDYDPVDKIILQKTHSIKNKT 184
            |.|..:.|:|.||..||||...:|.:::.|..||..||:.|:.|...|.                
Yeast   167 GDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDD---------------- 215

  Fly   185 LDVKKAIAKQDMDRQGGGGGRGGP-RAGGRGGQGDRGQGGGGWGGQNRQNGGGNWGGAGGGGGFG 248
                   |:..||...|....|.| |.              .|..:...|...|:          
Yeast   216 -------AQNAMDSMQGQDLNGRPLRI--------------NWAAKRDNNNNNNY---------- 249

  Fly   249 NSGGNFGGGQGGGSGGWNQQGGSGGGPWNNQGGGNGGWN 287
            ....|:|....||...:|.         ||....|.|.|
Yeast   250 QQRRNYGNNNRGGFRQYNS---------NNNNNMNMGMN 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hrb87FNP_001163602.1 RRM1_hnRNPA_like 25..102 CDD:241022 23/77 (30%)
RRM_SF 116..188 CDD:302621 22/71 (31%)
PUB1NP_014382.1 RRM1_PUB1 77..150 CDD:410026 22/73 (30%)
RRM2_PUB1 161..240 CDD:410031 30/115 (26%)
RRM3_PUB1 341..414 CDD:410033
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.