DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrb87F and AT1G76460

DIOPT Version :10

Sequence 1:NP_476806.2 Gene:Hrb87F / 48535 FlyBaseID:FBgn0004237 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_565132.2 Gene:AT1G76460 / 843979 AraportID:AT1G76460 Length:285 Species:Arabidopsis thaliana


Alignment Length:61 Identity:23/61 - (37%)
Similarity:41/61 - (67%) Gaps:0/61 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 IDSPNAGATVKKLFVGGLRDDHDEECLREYFKDFGQIVSVNIVSDKDTGKKRGFAFIEFDD 165
            ::||....|..|:|||||..:...|.||::|:.:|:|:...:::||:||:.:|:.|:.|.|
plant    14 LNSPFGDTTFTKVFVGGLAWETQSETLRQHFEQYGEILEAVVIADKNTGRSKGYGFVTFRD 74

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hrb87FNP_476806.2 RRM1_hnRNPA_like 25..102 CDD:409992
RRM_SF 116..188 CDD:473069 20/50 (40%)
AT1G76460NP_565132.2 RRM_RBM24_RBM38_like 24..99 CDD:409818 20/51 (39%)
PABP-1234 <37..245 CDD:130689 14/38 (37%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.