DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrb87F and AT1G60000

DIOPT Version :9

Sequence 1:NP_001163602.1 Gene:Hrb87F / 48535 FlyBaseID:FBgn0004237 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_176208.1 Gene:AT1G60000 / 842294 AraportID:AT1G60000 Length:258 Species:Arabidopsis thaliana


Alignment Length:165 Identity:52/165 - (31%)
Similarity:74/165 - (44%) Gaps:26/165 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 DDG-EEITEPEQL--RKLFIGGLDYRTTDDGLKAHFEKWGN--IVDVVVMKDPKTKRSRGFGFIT 71
            ||| ..:.:|...  .||:.|.|.|......|....:.:.|  :|:|:..:|  |.:||||.|:|
plant    70 DDGASAVLDPPAAVNTKLYFGNLPYNVDSATLAQIIQDFANPELVEVLYNRD--TGQSRGFAFVT 132

  Fly    72 YSQ----SYMIDNAQNARPHKIDGRTVEPKRAVPRQEIDSPNAG------ATVKKLFVGGLRDDH 126
            .|.    :.:|||        :|| |....||:.....|.|...      .|..|||||.|....
plant   133 MSNVEDCNIIIDN--------LDG-TEYLGRALKVNFADKPKPNKEPLYPETEHKLFVGNLSWTV 188

  Fly   127 DEECLREYFKDFGQIVSVNIVSDKDTGKKRGFAFI 161
            ..|.|...|::.|.:|...:|.|.|||:.||:.|:
plant   189 TSESLAGAFRECGDVVGARVVFDGDTGRSRGYGFV 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hrb87FNP_001163602.1 RRM1_hnRNPA_like 25..102 CDD:241022 26/82 (32%)
RRM_SF 116..188 CDD:302621 19/46 (41%)
AT1G60000NP_176208.1 RRM_SF 86..165 CDD:418427 27/89 (30%)
RRM2_NsCP33_like 178..253 CDD:410187 19/46 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.