DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrb87F and PAB8

DIOPT Version :9

Sequence 1:NP_001163602.1 Gene:Hrb87F / 48535 FlyBaseID:FBgn0004237 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_001185184.1 Gene:PAB8 / 841399 AraportID:AT1G49760 Length:671 Species:Arabidopsis thaliana


Alignment Length:152 Identity:42/152 - (27%)
Similarity:72/152 - (47%) Gaps:10/152 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LFIGGLDYRTTDDGLKAHFEKWGNIVDVVVMKDPKTKRSRGFGFITYSQSYMIDNAQNARPH-KI 89
            |::|.||...||..|...|.:.|.:|.|.|.:|..|:||.|:|::.|:.......|.|.... .:
plant    47 LYVGDLDATVTDSQLFEAFTQAGQVVSVRVCRDMTTRRSLGYGYVNYATPQDASRALNELNFMAL 111

  Fly    90 DGRTVEPKRAVPRQEIDSPNAGATVKKLFVGGLRDDHDEECLREYFKDFGQIVSVNIVSDKDTGK 154
            :||.:....:|....:.....|    .:|:..|....|.:.|.|.|..||.|:|..:..| .:|:
plant   112 NGRAIRVMYSVRDPSLRKSGVG----NIFIKNLDKSIDHKALHETFSAFGPILSCKVAVD-PSGQ 171

  Fly   155 KRGFAFIEFDDYD----PVDKI 172
            .:|:.|:::|..:    .:||:
plant   172 SKGYGFVQYDTDEAAQGAIDKL 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hrb87FNP_001163602.1 RRM1_hnRNPA_like 25..102 CDD:241022 24/76 (32%)
RRM_SF 116..188 CDD:302621 17/61 (28%)
PAB8NP_001185184.1 PABP-1234 46..646 CDD:130689 42/152 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.