DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrb87F and AT1G01080

DIOPT Version :9

Sequence 1:NP_001163602.1 Gene:Hrb87F / 48535 FlyBaseID:FBgn0004237 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_001030925.1 Gene:AT1G01080 / 839463 AraportID:AT1G01080 Length:294 Species:Arabidopsis thaliana


Alignment Length:171 Identity:48/171 - (28%)
Similarity:81/171 - (47%) Gaps:24/171 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 FEKWGNIVDV-VVMKDPKTKRSRGFGFITYSQSYMIDNAQNARPHKIDGRTVEPKRAVPRQEIDS 107
            |:.:|.::.| ||.::|:|..|||.|::|...   |::|:.|.. .:||..|..:....|..:|.
plant   128 FQPFGTVISVEVVSRNPQTGESRGSGYVTMGS---INSAKIAIA-SLDGTEVGGREMRVRYSVDM 188

  Fly   108 PNAG---------ATVKKL---------FVGGLRDDHDEECLREYFKDFGQIVSVNIVSDKDTGK 154
             |.|         :|.||:         :||.|......:.||.:|..||.|||..::.|:.||:
plant   189 -NPGTRRNPEVLNSTPKKILMYESQHKVYVGNLPWFTQPDGLRNHFSKFGTIVSTRVLHDRKTGR 252

  Fly   155 KRGFAFIEFDDYDPVDKIILQKTHSIKNKTLDVKKAIAKQD 195
            .|.|||:.|...:..|..:.......:.:.:.|::.|.|.:
plant   253 NRVFAFLSFTSGEERDAALSFNGTQYEGRRIIVREGIEKSE 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hrb87FNP_001163602.1 RRM1_hnRNPA_like 25..102 CDD:241022 18/58 (31%)
RRM_SF 116..188 CDD:302621 21/80 (26%)
AT1G01080NP_001030925.1 RRM_SF 110..183 CDD:302621 18/58 (31%)
RRM 214..285 CDD:214636 20/70 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.