DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrb87F and AT5G65260

DIOPT Version :9

Sequence 1:NP_001163602.1 Gene:Hrb87F / 48535 FlyBaseID:FBgn0004237 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_201329.1 Gene:AT5G65260 / 836651 AraportID:AT5G65260 Length:220 Species:Arabidopsis thaliana


Alignment Length:77 Identity:18/77 - (23%)
Similarity:39/77 - (50%) Gaps:1/77 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 EPEQLRKLFIGGLDYRTTDDGLKAHFEKWGNIVDVVVMKDPKTKRSRGFGFITYSQSYMIDNAQN 83
            |....|.:|:|.:||..|.:.::.||:..|.:..|.::.| |..:.:||.::.:.:...:..|..
plant    87 EEVDARSVFVGNVDYACTPEEVQQHFQTCGTVHRVTILTD-KFGQPKGFAYVEFVEVEAVQEALQ 150

  Fly    84 ARPHKIDGRTVE 95
            ....::.||.::
plant   151 LNESELHGRQLK 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hrb87FNP_001163602.1 RRM1_hnRNPA_like 25..102 CDD:241022 16/71 (23%)
RRM_SF 116..188 CDD:302621
AT5G65260NP_201329.1 RRM <51..>215 CDD:223796 18/77 (23%)
RRM_II_PABPs 93..164 CDD:409747 16/71 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.