DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrb87F and AT5G51730

DIOPT Version :9

Sequence 1:NP_001163602.1 Gene:Hrb87F / 48535 FlyBaseID:FBgn0004237 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_199986.2 Gene:AT5G51730 / 835247 AraportID:AT5G51730 Length:317 Species:Arabidopsis thaliana


Alignment Length:192 Identity:41/192 - (21%)
Similarity:71/192 - (36%) Gaps:73/192 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 SQSYMIDNAQNARPHKIDGRTVEPKR------AVPRQEIDSPNAGATVKKLFVGGLRDD------ 125
            |:|.:...:.:.|..:.:..||.||:      |..::::.|       .|:.|..|::|      
plant     5 SKSMLGSPSPDKRKAEDELETVNPKKKIICLIASIKEDVSS-------IKVVVDSLKEDVASLKA 62

  Fly   126 ---------------HDEECLREYFKDFGQI-VSV-NIV-------------------------- 147
                           .|...:...||:..:| .|| |||                          
plant    63 TVNSLKSTFDLLSTKKDSLAIFTSFKETARIPASVKNIVRPVIQNSASSEDLKISDQGEEPAHKK 127

  Fly   148 --SDKDTGKKRGFAFIEFDDYDPVDKIILQK---THSIKN--KTLDV-KKAIAKQDMDRQGG 201
              :|.:|.||.....:...:.|.|.|..|::   |:|.||  ||.:| ::|:.   :.:|||
plant   128 AKTDTNTCKKESSRNVSSKESDVVKKETLERTLPTYSFKNLTKTAEVGERALF---IPKQGG 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hrb87FNP_001163602.1 RRM1_hnRNPA_like 25..102 CDD:241022 8/34 (24%)
RRM_SF 116..188 CDD:302621 28/128 (22%)
AT5G51730NP_199986.2 RRM_SF 192..268 CDD:388407
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.