DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrb87F and AT5G19960

DIOPT Version :9

Sequence 1:NP_001163602.1 Gene:Hrb87F / 48535 FlyBaseID:FBgn0004237 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_568388.1 Gene:AT5G19960 / 832118 AraportID:AT5G19960 Length:337 Species:Arabidopsis thaliana


Alignment Length:263 Identity:56/263 - (21%)
Similarity:99/263 - (37%) Gaps:61/263 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 DDGEEITEPEQLRKLFIGGLDYRTTDDGLKAHFEKWGNIVDVVVMKDPKTKRSRGFGFITYSQSY 76
            |||..:         ::|||.|..|::.::..|..:|:::.|.::.| ::.|.:.:||:|:|...
plant     4 DDGNSV---------YVGGLPYDITEEAVRRVFSIYGSVLTVKIVND-RSVRGKCYGFVTFSNRR 58

  Fly    77 MIDNA-QNARPHKIDGRTVEPKRAVPRQEIDSPNAGATVKKLFVGG------LRDDHDEECLREY 134
            ..|:| ::.....|.||.|.......|....:|..|.....   ||      .|.|.:.|  |:.
plant    59 SADDAIEDMDGKSIGGRAVRVNDVTTRGGRMNPGPGRLQPH---GGWDRSPDRRSDGNYE--RDR 118

  Fly   135 FKDFGQIVSVNIVSDKDTGKKRGFAFIEFD-------------DYDPVDKIILQKTHSIKNKTLD 186
            :.|..:      ..|:...:::...:||.:             |:|.||:      :..|.:..|
plant   119 YSDRSR------ERDRSQDRRKDHRYIEKERAYEHSHDFERRNDHDMVDR------NGYKERVFD 171

  Fly   187 VKKAIAKQDMDRQGGGGGRGGPRAGGRGGQGDRGQGG-GGWGGQNRQNGGGNWGGAGGGGGFGNS 250
                         |..|...|.|:....|:|..|... .|...:.::.......|..|...|.||
plant   172 -------------GDEGDWRGDRSYVDNGRGINGTSAHEGRSQETKREDSTILDGGRGRDHFSNS 223

  Fly   251 GGN 253
            .|:
plant   224 SGD 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hrb87FNP_001163602.1 RRM1_hnRNPA_like 25..102 CDD:241022 20/77 (26%)
RRM_SF 116..188 CDD:302621 16/90 (18%)
AT5G19960NP_568388.1 RRM <4..158 CDD:223796 37/174 (21%)
RRM_SF 9..80 CDD:409669 20/80 (25%)
PRK12678 <103..>232 CDD:237171 28/151 (19%)
Smc <228..>323 CDD:224117
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.