DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrb87F and ATU2AF65A

DIOPT Version :9

Sequence 1:NP_001163602.1 Gene:Hrb87F / 48535 FlyBaseID:FBgn0004237 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_195387.1 Gene:ATU2AF65A / 829822 AraportID:AT4G36690 Length:573 Species:Arabidopsis thaliana


Alignment Length:209 Identity:50/209 - (23%)
Similarity:86/209 - (41%) Gaps:54/209 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 RKLFIGGLDYRTTDDGLKAHFEK-----WGN-------IVDVVVMKDPKTKRSRGFGFITYSQSY 76
            |::::|||.....:..:...|.:     .||       :|:|.:..:.|      |.|:   :..
plant   239 RRVYVGGLSPTANEQSVATFFSQVMAAVGGNTAGPGDAVVNVYINHEKK------FAFV---EMR 294

  Fly    77 MIDNAQNARPHKIDGRTVEPKRAVPRQEID-SPNAGATV-------------------------- 114
            .::.|.||.  .:||...|......|:..| :|:..||:                          
plant   295 SVEEASNAM--SLDGIIFEGAPVKVRRPSDYNPSLAATLGPSQPSPHLNLAAVGLTPGASGGLEG 357

  Fly   115 -KKLFVGGLRDDHDEECLREYFKDFGQIVSVNIVSDKDTGKKRGFAFIEFDDYDPVDKIILQKTH 178
             .::|||||.....|..:||..:.||.:...::|.|::||..:|:||..:.|....| |.....:
plant   358 PDRIFVGGLPYYFTESQVRELLESFGGLKGFDLVKDRETGNSKGYAFCVYQDLSVTD-IACAALN 421

  Fly   179 SIK--NKTLDVKKA 190
            .||  :|||.|::|
plant   422 GIKMGDKTLTVRRA 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hrb87FNP_001163602.1 RRM1_hnRNPA_like 25..102 CDD:241022 17/88 (19%)
RRM_SF 116..188 CDD:302621 25/73 (34%)
ATU2AF65ANP_195387.1 U2AF_lg 31..571 CDD:273727 50/209 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.