DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrb87F and RBP31

DIOPT Version :9

Sequence 1:NP_001163602.1 Gene:Hrb87F / 48535 FlyBaseID:FBgn0004237 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_001328008.1 Gene:RBP31 / 828579 AraportID:AT4G24770 Length:329 Species:Arabidopsis thaliana


Alignment Length:214 Identity:60/214 - (28%)
Similarity:109/214 - (50%) Gaps:21/214 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAEQNDSNGNYDDG-----EEITEPEQLRKLFIGGLDYRTTDDGLKAHFEKWGNIVDVVVMKDPK 60
            ::|.::|.|:..:|     .|..||.:..|||:|.|.|......|...||:.|.:....|:.:.:
plant   122 VSEGDESEGDVSEGAVSERAEFPEPSEEAKLFVGNLAYDVNSQALAMLFEQAGTVEIAEVIYNRE 186

  Fly    61 TKRSRGFGFITYSQSYMIDNAQNA----RPHKIDGRTVEPKRAVPR--QEIDSPNAGATVKKLFV 119
            |.:||||||:|.|.   :|.|:.|    ..:.::||.:...:|.||  :...:|.......:::|
plant   187 TDQSRGFGFVTMSS---VDEAETAVEKFNRYDLNGRLLTVNKAAPRGSRPERAPRVYEPAFRVYV 248

  Fly   120 GGLRDDHDEECLREYFKDFGQIVSVNIVSDKDTGKKRGFAFIEFDDYDPVDKIILQKTHSIKNKT 184
            |.|..|.|...|.:.|.:.|::|...:|.|::||:.|||.|:...|.|.:::.|    .::..:.
plant   249 GNLPWDVDNGRLEQLFSEHGKVVEARVVYDRETGRSRGFGFVTMSDVDELNEAI----SALDGQN 309

  Fly   185 LD---VKKAIAKQDMDRQG 200
            |:   ::..:|::...|:|
plant   310 LEGRAIRVNVAEERPPRRG 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hrb87FNP_001163602.1 RRM1_hnRNPA_like 25..102 CDD:241022 26/80 (33%)
RRM_SF 116..188 CDD:302621 21/74 (28%)
RBP31NP_001328008.1 RRM_HP0827_like 151..228 CDD:240845 26/79 (33%)
RRM_HP0827_like 245..321 CDD:240845 21/79 (27%)
DNA_pol_phi <87..145 CDD:368199 5/22 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.