DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrb87F and AT4G14300

DIOPT Version :9

Sequence 1:NP_001163602.1 Gene:Hrb87F / 48535 FlyBaseID:FBgn0004237 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_001328758.1 Gene:AT4G14300 / 827071 AraportID:AT4G14300 Length:411 Species:Arabidopsis thaliana


Alignment Length:423 Identity:142/423 - (33%)
Similarity:200/423 - (47%) Gaps:91/423 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 KLFIGGLDYRTTDDGLKAHFEKWGNIVDVVVMKDPKTKRSRGFGFITYSQSYMIDNAQNARPHKI 89
            |||:||:.:.|.:|.|:.||..:|.:...:||:|..|.|.|||||:.:|...::|.....: |.|
plant     7 KLFVGGISWETDEDKLREHFTNYGEVSQAIVMRDKLTGRPRGFGFVIFSDPSVLDRVLQEK-HSI 70

  Fly    90 DGRTVEPKRAVPRQEID----------SPNAGA----TVKKLFVGGLRDDHDEECLREYFKDFGQ 140
            |.|.|:.|||:.|:|..          |.::|.    ..||:|||||.....:|..|:||:.:|.
plant    71 DTREVDVKRAMSREEQQVSGRTGNLNTSRSSGGDAYNKTKKIFVGGLPPTLTDEEFRQYFEVYGP 135

  Fly   141 IVSVNIVSDKDTGKKRGFAFIEFDDYDPVDKIILQKTHSIKNKTLDVKKAIAKQDMDRQGGGGGR 205
            :..|.|:.|:.|.:.|||.|:.||..|.||.::.:..|.:..|.::||:|:.|   |...|||||
plant   136 VTDVAIMYDQATNRPRGFGFVSFDSEDAVDSVLHKTFHDLSGKQVEVKRALPK---DANPGGGGR 197

  Fly   206 GGPRAGGRGGQGDRGQGG--GGWGG----------QNRQNGGGNWGGAGGGGGFGN--SGGNFG- 255
            .   .||.|..|.:|.||  ..:.|          |:..||..::|.:|.|.|:||  :|..:| 
plant   198 S---MGGGGSGGYQGYGGNESSYDGRMDSNRFLQHQSVGNGLPSYGSSGYGAGYGNGSNGAGYGA 259

  Fly   256 -GGQGGGSGGWNQQGGSGGGPWNNQGGGNG---------GW-----NGGGGGGYGGGNSNGSWG- 304
             ||..|.:||:.....:|.|..|..|.|.|         .|     :|.|..|||.|.::..:| 
plant   260 YGGYTGSAGGYGAGATAGYGATNIPGAGYGSSTGVAPRNSWDTPASSGYGNPGYGSGAAHSGYGV 324

  Fly   305 ------------------GNGGGGGGGGGFGNEYQQSYG--GGPQRNSNFGNNRPAPYSQGGGGG 349
                              |.||..|...|:||  |.:||  ||  |.|..|:|.|       |.|
plant   325 PGAAPPTQSPSGYSNQGYGYGGYSGSDSGYGN--QAAYGVVGG--RPSGGGSNNP-------GSG 378

  Fly   350 GFNKGNQGGG-------QGFAGNNYNTGGGGQG 375
            |:..|..|.|       ||: |..||.|.|.||
plant   379 GYMGGGYGDGSWRSDPSQGY-GGGYNDGQGRQG 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hrb87FNP_001163602.1 RRM1_hnRNPA_like 25..102 CDD:241022 31/76 (41%)
RRM_SF 116..188 CDD:302621 26/71 (37%)
AT4G14300NP_001328758.1 RRM1_hnRNPA_hnRNPD_like 8..78 CDD:409763 27/70 (39%)
RRM2_Hrp1p 111..188 CDD:409767 29/76 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.