DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrb87F and AT4G09040

DIOPT Version :9

Sequence 1:NP_001163602.1 Gene:Hrb87F / 48535 FlyBaseID:FBgn0004237 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_192643.2 Gene:AT4G09040 / 826483 AraportID:AT4G09040 Length:304 Species:Arabidopsis thaliana


Alignment Length:171 Identity:41/171 - (23%)
Similarity:78/171 - (45%) Gaps:20/171 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 DSNGNYDDGEEITEPE-QLRKLFIGGLDYRTTDDGLKAHFEKWGNIVDVVVMKDPKTKRSRGFGF 69
            :|:.:.....|:.|.| ...:|....:.:.:|.:.:::.|||:|:::| :.|...|.:|:||..|
plant    75 ESSSSSSSAPEVVEEEISKTRLIAQNVPWTSTPEDIRSLFEKYGSVID-IEMSMHKKERNRGLVF 138

  Fly    70 ITYSQSYMIDNAQNA-----------RPHKIDGRTVEPKRAVPRQEIDSPNAGATVKKLFVGGLR 123
            |..:..   :.|..|           |..|:|....:.|:....:|..||   .....|||..|.
plant   139 IEMASP---EEAATALKSLESCEYEGRRLKVDYAKTKKKKTYAPRETPSP---VPTFNLFVANLA 197

  Fly   124 DDHDEECLREYF-KDFGQIVSVNIVSDKDTGKKRGFAFIEF 163
            .:...:.|:|:| .|.|.:||..::..::..:..|:.|:.|
plant   198 FEARAKHLKEFFDADTGNVVSTEVIFHENPRRSSGYGFVSF 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hrb87FNP_001163602.1 RRM1_hnRNPA_like 25..102 CDD:241022 20/87 (23%)
RRM_SF 116..188 CDD:302621 14/49 (29%)
AT4G09040NP_192643.2 RRM_SF 100..167 CDD:409669 17/70 (24%)
RRM 190..263 CDD:214636 14/49 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.