DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrb87F and UBA2A

DIOPT Version :9

Sequence 1:NP_001163602.1 Gene:Hrb87F / 48535 FlyBaseID:FBgn0004237 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_001190109.1 Gene:UBA2A / 824853 AraportID:AT3G56860 Length:478 Species:Arabidopsis thaliana


Alignment Length:407 Identity:98/407 - (24%)
Similarity:142/407 - (34%) Gaps:115/407 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 EQNDSN----------GNYDDG-----EEITEP---EQL-------------------------- 23
            :|.|.|          ||.:|.     :::.||   ||:                          
plant    73 DQTDGNRIEAAATSGSGNQEDDDDEPIQDLLEPFSKEQVLSLLKEAAEKHVDVANRIREVADEDP 137

  Fly    24 --RKLFIGGLDYRTTDDGLKAHFEKWGNIVDVVVMKDPKTKRSRGFGFITYSQSYMIDNAQNARP 86
              ||:|:.||.:.|..:.|...|:::|.|.|...:.|..:.:|:|:|||.|.......||.....
plant   138 VHRKIFVHGLGWDTKTETLIEAFKQYGEIEDCKAVFDKISGKSKGYGFILYKSRSGARNALKQPQ 202

  Fly    87 HKIDGRTVEPKRA----------VPRQEIDSP----NAGATVKKLFVGGLRDDHDEECLREYFKD 137
            .||..|....:.|          :....:.:|    |:..|.||::|..:..:.|.:.|..:|..
plant   203 KKIGSRMTACQLASKGPVFGGAPIAAAAVSAPAQHSNSEHTQKKIYVSNVGAELDPQKLLMFFSK 267

  Fly   138 FGQIVSVNIVSDKDTGKKRGFAFIEFDDYDPVDKIILQKTHSIKNKTLDVKKAI-----AKQDM- 196
            ||:|....:..||.||:.:||....:...:...:.:.:...:.:...|..:|||     .||.. 
plant   268 FGEIEEGPLGLDKYTGRPKGFCLFVYKSSESAKRALEEPHKTFEGHILHCQKAIDGPKPGKQQQH 332

  Fly   197 ---------------DRQGGG--GGRGGPRAGGRGGQGDR---------GQG--------GGGWG 227
                           |..|.|  ||.|...||...|.|..         ||.        |.|..
plant   333 HHNPHAYNNPRYQRNDNNGYGPPGGHGHLMAGNPAGMGGPTAQVINPAIGQALTALLASQGAGLA 397

  Fly   228 -----GQNRQNGGGNWGGAGGGGGFGNSGGNFGGGQGGGSG---GWNQQGGSGGG---PWNNQGG 281
                 ||......|...|...|.|.|...|.  |.|....|   |:..|.|..||   |...|||
plant   398 FNPAIGQALLGSLGTAAGVNPGNGVGMPTGY--GTQAMAPGTMPGYGTQPGLQGGYQTPQPGQGG 460

  Fly   282 GNGGWNGGG--GGGYGG 296
            .:.|.:|.|  |..|.|
plant   461 TSRGQHGVGPYGTPYMG 477

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hrb87FNP_001163602.1 RRM1_hnRNPA_like 25..102 CDD:241022 23/86 (27%)
RRM_SF 116..188 CDD:302621 15/71 (21%)
UBA2ANP_001190109.1 PABP-1234 136..>347 CDD:130689 48/210 (23%)
RRM_SF 140..215 CDD:418427 23/74 (31%)
Med15 361..>465 CDD:312941 28/105 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.