DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrb87F and PHIP1

DIOPT Version :9

Sequence 1:NP_001163602.1 Gene:Hrb87F / 48535 FlyBaseID:FBgn0004237 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_191094.1 Gene:PHIP1 / 824700 AraportID:AT3G55340 Length:597 Species:Arabidopsis thaliana


Alignment Length:171 Identity:49/171 - (28%)
Similarity:84/171 - (49%) Gaps:23/171 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 NYDDGEEITEPEQLRKLFIGGLDYRTTDDGLKAHFEKWGNIVDVVVMKDPKTKRSRGFGFITYSQ 74
            |.|:.||  :.....||::||:.|::|:|.::::|...|.|:.|.....|:.....|..|||:..
plant   149 NTDNKEE--DGVVPNKLYVGGIPYQSTEDEIRSYFRSCGVIIKVDCKMRPEDGAFSGIAFITFDT 211

  Fly    75 SYMIDNAQNA----RPHKIDG--------RTVEPKRAVPRQEIDSPNAGATV---KKLFVGGLRD 124
            .   |.|:.|    |....|.        :|..|  ::||::..|..|...|   .::::|.|..
plant   212 E---DGAKRALAFDRAAMGDRYLTIQQYVKTTTP--SIPRRKTSSGFAPEMVDGYNRVYIGNLAW 271

  Fly   125 DHDEECLREYFKDFGQIVSVNIVSDKDTGKKRGFAFIEFDD 165
            |..|..:|:.|.|. .|.||.:..:|:||:.:|:|.::|.|
plant   272 DTTERDIRKLFSDC-VINSVRLGKNKETGEFKGYAHVDFKD 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hrb87FNP_001163602.1 RRM1_hnRNPA_like 25..102 CDD:241022 23/88 (26%)
RRM_SF 116..188 CDD:302621 17/50 (34%)
PHIP1NP_191094.1 RRM <129..327 CDD:223796 49/171 (29%)
RRM1_PHIP1 163..234 CDD:240717 20/73 (27%)
RRM2_PHIP1 263..334 CDD:240718 17/50 (34%)
PTZ00368 393..592 CDD:173561
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.