DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrb87F and ARP1

DIOPT Version :9

Sequence 1:NP_001163602.1 Gene:Hrb87F / 48535 FlyBaseID:FBgn0004237 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_191037.1 Gene:ARP1 / 824642 AraportID:AT3G54770 Length:261 Species:Arabidopsis thaliana


Alignment Length:92 Identity:30/92 - (32%)
Similarity:51/92 - (55%) Gaps:7/92 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAEQNDSNGNYDDGEEITEPEQLRKLFIGGLDYRTTDDGLKAHFEKWGNIVDVVVMKDPKTKRSR 65
            |...|:.||.:.|       .:|.|:|:|||.:.|..:.:..||.|:|:|::.|::.|..|:||:
plant     1 MTTSNNVNGCFGD-------TKLTKVFVGGLAWDTHKEAMYDHFIKYGDILEAVIISDKLTRRSK 58

  Fly    66 GFGFITYSQSYMIDNAQNARPHKIDGR 92
            |:||:|:..:.....|.......|:||
plant    59 GYGFVTFKDAKAATRACEDSTPIINGR 85

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hrb87FNP_001163602.1 RRM1_hnRNPA_like 25..102 CDD:241022 24/68 (35%)
RRM_SF 116..188 CDD:302621
ARP1NP_191037.1 RRM <17..>121 CDD:223796 24/69 (35%)
RRM_RBM24_RBM38_like 17..92 CDD:240830 24/69 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.