DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrb87F and CP29

DIOPT Version :9

Sequence 1:NP_001163602.1 Gene:Hrb87F / 48535 FlyBaseID:FBgn0004237 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_001190079.1 Gene:CP29 / 824514 AraportID:AT3G53460 Length:363 Species:Arabidopsis thaliana


Alignment Length:202 Identity:60/202 - (29%)
Similarity:84/202 - (41%) Gaps:26/202 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 KLFVGGLRDDHDEECLREYFKDFGQIVSVNIVSDKDTGKKRGFAFIEFDDYDPVDKIILQKTHSI 180
            |||||.|..:.|...|.:.|:..|.:..|.::.||.||:.|||.|:.......|:....|....:
plant   100 KLFVGNLSFNVDSAQLAQLFESAGNVEMVEVIYDKVTGRSRGFGFVTMSTAAEVEAAAQQFNGYV 164

  Fly   181 KNKTLDVK------KAIAKQDMDRQGGGGGR-----GGPRAGGRGGQGDRGQGGGGWGGQNRQNG 234
            ......:.      :.:...:.:      ||     .||....|.....||...||:|.:.    
plant   165 SRYLCSLLCLYLLIRVLCGLEFE------GRPLRVNAGPPPPKREESFSRGPRSGGYGSER---- 219

  Fly   235 GGNWGGAGGGGGFGNSGGNFGGGQGGGSGGWNQQGGSGGGPWNNQGGGNGGWNGGGGGG--YGGG 297
            ||.:|...|||.....||.:|..:|||.|.....||.||...::.|.|:|..:|.|.|.  |.| 
plant   220 GGGYGSERGGGYGSERGGGYGSERGGGYGSQRSGGGYGGSQRSSYGSGSGSGSGSGSGNRLYVG- 283

  Fly   298 NSNGSWG 304
              |.|||
plant   284 --NLSWG 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hrb87FNP_001163602.1 RRM1_hnRNPA_like 25..102 CDD:241022
RRM_SF 116..188 CDD:302621 21/71 (30%)
CP29NP_001190079.1 RRM_SF 100..194 CDD:302621 23/99 (23%)
RRM_HP0827_like 279..355 CDD:240845 6/13 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.