DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrb87F and CP29

DIOPT Version :10

Sequence 1:NP_476806.2 Gene:Hrb87F / 48535 FlyBaseID:FBgn0004237 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_001190079.1 Gene:CP29 / 824514 AraportID:AT3G53460 Length:363 Species:Arabidopsis thaliana


Alignment Length:202 Identity:60/202 - (29%)
Similarity:84/202 - (41%) Gaps:26/202 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 KLFVGGLRDDHDEECLREYFKDFGQIVSVNIVSDKDTGKKRGFAFIEFDDYDPVDKIILQKTHSI 180
            |||||.|..:.|...|.:.|:..|.:..|.::.||.||:.|||.|:.......|:....|....:
plant   100 KLFVGNLSFNVDSAQLAQLFESAGNVEMVEVIYDKVTGRSRGFGFVTMSTAAEVEAAAQQFNGYV 164

  Fly   181 KNKTLDVK------KAIAKQDMDRQGGGGGR-----GGPRAGGRGGQGDRGQGGGGWGGQNRQNG 234
            ......:.      :.:...:.:      ||     .||....|.....||...||:|.:.    
plant   165 SRYLCSLLCLYLLIRVLCGLEFE------GRPLRVNAGPPPPKREESFSRGPRSGGYGSER---- 219

  Fly   235 GGNWGGAGGGGGFGNSGGNFGGGQGGGSGGWNQQGGSGGGPWNNQGGGNGGWNGGGGGG--YGGG 297
            ||.:|...|||.....||.:|..:|||.|.....||.||...::.|.|:|..:|.|.|.  |.| 
plant   220 GGGYGSERGGGYGSERGGGYGSERGGGYGSQRSGGGYGGSQRSSYGSGSGSGSGSGSGNRLYVG- 283

  Fly   298 NSNGSWG 304
              |.|||
plant   284 --NLSWG 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hrb87FNP_476806.2 RRM1_hnRNPA_like 25..102 CDD:409992
RRM_SF 116..188 CDD:473069 21/71 (30%)
CP29NP_001190079.1 U2AF_lg <45..>144 CDD:273727 18/43 (42%)
RRM_SF 100..199 CDD:473069 25/104 (24%)
RRM 278..361 CDD:440488 6/14 (43%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.