DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrb87F and CP33

DIOPT Version :9

Sequence 1:NP_001163602.1 Gene:Hrb87F / 48535 FlyBaseID:FBgn0004237 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_190806.1 Gene:CP33 / 824403 AraportID:AT3G52380 Length:329 Species:Arabidopsis thaliana


Alignment Length:202 Identity:58/202 - (28%)
Similarity:94/202 - (46%) Gaps:42/202 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 EQNDSNGNYDDGEEITEPEQLR--------KLFIGGLDYRTTDDGLKAHFEKWGNIVDVVVMKDP 59
            |:.:.....|:|||..|.|:..        :|::|.|.|..|...|...|.:.|.:|||.::.|.
plant    87 EEEEVEEEGDEGEEEVEEEKQTTQASGEEGRLYVGNLPYTITSSELSQIFGEAGTVVDVQIVYDK 151

  Fly    60 KTKRSRGFGFITYSQSYMIDNAQNA----RPHKIDGRTVE---PKRAVP---------------- 101
            .|.|||||||:|...   |:.|:.|    ...:|.||||:   |:  ||                
plant   152 VTDRSRGFGFVTMGS---IEEAKEAMQMFNSSQIGGRTVKVNFPE--VPRGGENEVMRTKIRDNN 211

  Fly   102 RQEIDSPNAGATVKKLFVGGLRDDHDEECLREYFKDFGQIVSVNIVSDKDTGKKRGFAFIEFDDY 166
            |..:|||:      |::.|.|..:...:.|::.|.|...::...::.:::||:.|||.||.|:..
plant   212 RSYVDSPH------KVYAGNLGWNLTSQGLKDAFGDQPGVLGAKVIYERNTGRSRGFGFISFESA 270

  Fly   167 DPVDKII 173
            :.|...:
plant   271 ENVQSAL 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hrb87FNP_001163602.1 RRM1_hnRNPA_like 25..102 CDD:241022 32/99 (32%)
RRM_SF 116..188 CDD:302621 15/58 (26%)
CP33NP_190806.1 RRM_HP0827_like 117..193 CDD:240845 29/78 (37%)
RRM_SF 220..295 CDD:302621 15/58 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.