DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrb87F and PSRP2

DIOPT Version :9

Sequence 1:NP_001163602.1 Gene:Hrb87F / 48535 FlyBaseID:FBgn0004237 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_001030841.1 Gene:PSRP2 / 824379 AraportID:AT3G52150 Length:253 Species:Arabidopsis thaliana


Alignment Length:191 Identity:55/191 - (28%)
Similarity:88/191 - (46%) Gaps:31/191 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 EQLRKLFIGGLDYRTTDDGLKAHFEKWGNIVDVVVMKDPKTKRSRGFGFITYSQSYMIDNAQNAR 85
            |..|:::||.:....|::.|....|:.|.:..|.||.|..:.|||.|||.|...   :::| ||.
plant    73 EAARRVYIGNIPRTVTNEQLTKLVEEHGAVEKVQVMYDKYSGRSRRFGFATMKS---VEDA-NAV 133

  Fly    86 PHKIDGRTVE----------------PKRAVPRQE----IDSPNAGATVKKLFVGGLRDDHDEEC 130
            ..|::|.|||                |..:|.:.|    :|||      .|::||.|.....:|.
plant   134 VEKLNGNTVEGREIKVNITEKPIASSPDLSVLQSEDSAFVDSP------YKVYVGNLAKTVTKEM 192

  Fly   131 LREYFKDFGQIVSVNIVSDKDTGKKRGFAFIEFDDYDPVDKIILQKTHS-IKNKTLDVKKA 190
            |...|.:.|::||..:.....|.|..||.|:.|...:.|:..|:...:| ::.:.:.|.||
plant   193 LENLFSEKGKVVSAKVSRVPGTSKSTGFGFVTFSSEEDVEAAIVALNNSLLEGQKIRVNKA 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hrb87FNP_001163602.1 RRM1_hnRNPA_like 25..102 CDD:241022 27/92 (29%)
RRM_SF 116..188 CDD:302621 19/72 (26%)
PSRP2NP_001030841.1 RRM_SF 77..154 CDD:327398 25/80 (31%)
RRM <78..>253 CDD:330708 51/184 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.