DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrb87F and NUC-L2

DIOPT Version :9

Sequence 1:NP_001163602.1 Gene:Hrb87F / 48535 FlyBaseID:FBgn0004237 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_188491.1 Gene:NUC-L2 / 821392 AraportID:AT3G18610 Length:636 Species:Arabidopsis thaliana


Alignment Length:278 Identity:69/278 - (24%)
Similarity:118/278 - (42%) Gaps:50/278 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 EQNDSNGNYDDGEEITEPEQ-----------LRKLFIGGLDYRTTDDGLKAHFEKWGNIVDVVV- 55
            ::.||:....|.|:.:..:|           .:.||.|.|.|:.....::..|::.|.:|||.: 
plant   352 KKKDSDVEMVDAEQKSNAKQPKTPTNQTQGGSKTLFAGNLSYQIARSDIENFFKEAGEVVDVRLS 416

  Fly    56 -MKDPKTKRSRGFGFITYSQSYMIDNAQNARPHKIDGRTVE----PKRAVPRQEIDSP---NAGA 112
             ..|...|   |:|.|.::.......|.......:.||.|.    .:|..||.  .:|   ..|:
plant   417 SFDDGSFK---GYGHIEFASPEEAQKALEMNGKLLLGRDVRLDLANERGTPRN--SNPGRKGEGS 476

  Fly   113 TVKKLFVGG----LRDDHDEECLREYFKDFGQIVSVNIVSDKDTGKKRGFAFIE----FDDYDPV 169
            ..:.::|.|    |.:|..::.||.:|...|::..|::.:|::||..||||:|:    ||:    
plant   477 QSRTIYVRGFSSSLGEDEIKKELRSHFSKCGEVTRVHVPTDRETGASRGFAYIDLTSGFDE---- 537

  Fly   170 DKIILQKTHS-IKNKTLDVKKAIAKQDMDRQGGGGGRGGPRAGGRGGQGDRGQGGGGWG-----G 228
               .||.:.| |....:.|::: ..:|.| :|....|...|...||...||...||.:.     |
plant   538 ---ALQLSGSEIGGGNIHVEES-RPRDSD-EGRSSNRAPARGAPRGRHSDRAPRGGRFSDRAPRG 597

  Fly   229 QNRQNGG--GNWGGAGGG 244
            ::...|.  |.:...|.|
plant   598 RHSDRGAPRGRFSTRGRG 615

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hrb87FNP_001163602.1 RRM1_hnRNPA_like 25..102 CDD:241022 20/82 (24%)
RRM_SF 116..188 CDD:302621 23/80 (29%)
NUC-L2NP_188491.1 RRM1_NUCLs 385..461 CDD:409884 19/78 (24%)
RRM2_NUCLs 480..556 CDD:409885 24/82 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.