DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrb87F and AT3G04500

DIOPT Version :9

Sequence 1:NP_001163602.1 Gene:Hrb87F / 48535 FlyBaseID:FBgn0004237 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_187100.1 Gene:AT3G04500 / 819606 AraportID:AT3G04500 Length:245 Species:Arabidopsis thaliana


Alignment Length:157 Identity:34/157 - (21%)
Similarity:69/157 - (43%) Gaps:26/157 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 FGFITYSQSYMI--DNAQNARPHKIDG------------RTVEPKRAVPR----QEIDSPNAGAT 113
            :.:..|.|::.:  .:||...|..::.            :....|||:||    |..:.|.....
plant    68 YAYPQYQQAHQLFQRDAQTITPEALENVKAALASSETEHKAETKKRAIPRKAAGQSWEDPTLSEW 132

  Fly   114 VK---KLFVGGLRDDHDEECLREYFKDFGQIVSVNIVSDKDTGKKRGFAFIEFDDYDPVDKIILQ 175
            .:   :||.|.|.::.:::.|.:.|..|.......::.||.|||.:|:.|:.|  .:|.|.....
plant   133 PENDYRLFCGDLGNEVNDDVLSKAFARFPTFNMAKVIRDKRTGKTKGYGFVSF--LNPADLAAAL 195

  Fly   176 KTHS---IKNKTLDVKKAIAKQDMDRQ 199
            |..:   :.|:.:.::|:..|:..|::
plant   196 KEMNGKYVGNRPIKLRKSSWKERTDQE 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hrb87FNP_001163602.1 RRM1_hnRNPA_like 25..102 CDD:241022 8/48 (17%)
RRM_SF 116..188 CDD:302621 19/74 (26%)
AT3G04500NP_187100.1 RRM 64..>242 CDD:223796 34/157 (22%)
RRM_RBM42 131..213 CDD:409817 19/83 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.