DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrb87F and RS31a

DIOPT Version :9

Sequence 1:NP_001163602.1 Gene:Hrb87F / 48535 FlyBaseID:FBgn0004237 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_182184.1 Gene:RS31a / 819273 AraportID:AT2G46610 Length:250 Species:Arabidopsis thaliana


Alignment Length:217 Identity:49/217 - (22%)
Similarity:84/217 - (38%) Gaps:64/217 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LRKLFIGGLDYRTTDDGLKAHFEKWGNIVDVVVMKDPKTKRSRGFGFITYSQSYMIDNA------ 81
            :|.:::|..||.|....|:..|.|:|.:..|    |.|:    |:.|:.:......::|      
plant     1 MRHVYVGNFDYDTRHSDLERLFSKFGRVKRV----DMKS----GYAFVYFEDERDAEDAIRRTDN 57

  Fly    82 ------------------QNARPHKIDGRTVEPKRAVPRQEIDSPNAGATVKKLFVGGLRDD--- 125
                              |..|....||:.|..:|              ..|.|||  :..|   
plant    58 TTFGYGRRKLSVEWAKDFQGERGKPRDGKAVSNQR--------------PTKTLFV--INFDPIR 106

  Fly   126 HDEECLREYFKDFGQIVSVNIVSDKDTGKKRGFAFIEFDDYDPVDKIILQKTHSIK--NKTLDVK 188
            ..|..:..:|:.:|::::|.:        :|.|||::|...:...| .|..||:.|  :|.:.|:
plant   107 TRERDMERHFEPYGKVLNVRM--------RRNFAFVQFATQEDATK-ALDSTHNSKLLDKVVSVE 162

  Fly   189 KAI--AKQDMDRQGGGGGRGGP 208
            .|:  |.:..||..|...|..|
plant   163 YALREAGEREDRYAGSRRRRSP 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hrb87FNP_001163602.1 RRM1_hnRNPA_like 25..102 CDD:241022 20/100 (20%)
RRM_SF 116..188 CDD:302621 19/76 (25%)
RS31aNP_182184.1 RRM_SF 2..73 CDD:302621 15/78 (19%)
RRM_SF 96..165 CDD:302621 20/79 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.