DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrb87F and AT2G37220

DIOPT Version :9

Sequence 1:NP_001163602.1 Gene:Hrb87F / 48535 FlyBaseID:FBgn0004237 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_181259.1 Gene:AT2G37220 / 818299 AraportID:AT2G37220 Length:289 Species:Arabidopsis thaliana


Alignment Length:203 Identity:58/203 - (28%)
Similarity:92/203 - (45%) Gaps:37/203 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 DDG-EEITEPEQLR-----KLFIGGLDYRTTDDGLKAHFEKWGNIVDVVVMKDPKTKRSRGFGFI 70
            :|| .::..|::..     |||:|.|.:......|...||..||:..|.|:.|..|.|||||||:
plant    73 EDGFADVAPPKEQSFSADLKLFVGNLPFNVDSAQLAQLFESAGNVEMVEVIYDKITGRSRGFGFV 137

  Fly    71 TYSQSYMID-NAQNARPHKIDGRTVE-------PKR-----AVPRQEIDSPNAG---------AT 113
            |.|....:: .||....:::|||.:.       |||     ..||....|..:|         .:
plant   138 TMSSVSEVEAAAQQFNGYELDGRPLRVNAGPPPPKREDGFSRGPRSSFGSSGSGYGGGGGSGAGS 202

  Fly   114 VKKLFVGGLRDDHDEECLREYFKDFGQIVSVNIVSDKDTGKKRGFAFIEFDDYDPVDKIILQKTH 178
            ..:::||.|....|:..|...|.:.|::|...::.|:|:|:.:||.|:.:|....|...|     
plant   203 GNRVYVGNLSWGVDDMALESLFSEQGKVVEARVIYDRDSGRSKGFGFVTYDSSQEVQNAI----- 262

  Fly   179 SIKNKTLD 186
                |:||
plant   263 ----KSLD 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hrb87FNP_001163602.1 RRM1_hnRNPA_like 25..102 CDD:241022 31/89 (35%)
RRM_SF 116..188 CDD:302621 20/71 (28%)
AT2G37220NP_181259.1 RRM_SF 92..170 CDD:418427 28/77 (36%)
RRM2_NsCP33_like 205..280 CDD:410187 20/71 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.