DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hrb87F and AT2G35410

DIOPT Version :9

Sequence 1:NP_001163602.1 Gene:Hrb87F / 48535 FlyBaseID:FBgn0004237 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_181084.1 Gene:AT2G35410 / 818107 AraportID:AT2G35410 Length:308 Species:Arabidopsis thaliana


Alignment Length:197 Identity:56/197 - (28%)
Similarity:85/197 - (43%) Gaps:35/197 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAEQNDSNGNYDDGEEITEPEQ----LRKLFIGGLDYRTTDDGLKAHFEKWG--NIVDVVVMKDP 59
            :||:..|.......||.||..|    .||||:..|.:..:.:.:...|.:.|  |.|:::..||.
plant    68 VAEKETSADEETSQEEKTEETQNSNLKRKLFVFNLPWSMSVNDISELFGQCGTVNNVEIIRQKDG 132

  Fly    60 KTKRSRGFGFITYSQSYMIDNAQNA----RPHKIDGRTVEP------KRAVPR--QEIDSPNAGA 112
            |   :|||.|:|.:..   :.||.|    ...::.||.:..      |:..|:  .::.||..|.
plant   133 K---NRGFAFVTMASG---EEAQAAIDKFDTFQVSGRIISVSFARRFKKPTPKSPNDLPSPAPGD 191

  Fly   113 TVKKLFVGGL----RDDHDEECLREYF--KDFGQIVSVNIVSDKDTGKKRGFAFIEFDDYDPVDK 171
            |..||:|..|    |..|    |||.|  .||.. ||..:|.....|:..|:.|:.|...:..:.
plant   192 TRHKLYVSNLAWKARSTH----LRELFTAADFNP-VSARVVFADPEGRSSGYGFVSFATREEAEN 251

  Fly   172 II 173
            .|
plant   252 AI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hrb87FNP_001163602.1 RRM1_hnRNPA_like 25..102 CDD:241022 22/88 (25%)
RRM_SF 116..188 CDD:302621 20/64 (31%)
AT2G35410NP_181084.1 PABP-1234 97..>279 CDD:130689 46/168 (27%)
RRM_SF 97..168 CDD:409669 20/76 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.